Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LBH4

Protein Details
Accession A0A4Q9LBH4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-31NSQFDRPSGPRKRHMRPKPSKEEVAGHydrophilic
NLS Segment(s)
PositionSequence
14-25GPRKRHMRPKPS
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MNNRHNSQFDRPSGPRKRHMRPKPSKEEVAGLKLLAVLNSLKKITVKIENVSNVIIEYTDKRVEYEKAVVKAIVMNKEDLKTPVAYIISGIAKNVVIKEEKTDYRNTYSSLIEDCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.68
3 0.69
4 0.75
5 0.78
6 0.83
7 0.84
8 0.86
9 0.89
10 0.9
11 0.88
12 0.83
13 0.73
14 0.7
15 0.62
16 0.55
17 0.45
18 0.34
19 0.26
20 0.23
21 0.21
22 0.14
23 0.11
24 0.08
25 0.08
26 0.1
27 0.1
28 0.09
29 0.1
30 0.11
31 0.13
32 0.19
33 0.2
34 0.21
35 0.24
36 0.25
37 0.25
38 0.24
39 0.21
40 0.14
41 0.12
42 0.09
43 0.07
44 0.06
45 0.08
46 0.09
47 0.09
48 0.1
49 0.11
50 0.13
51 0.14
52 0.19
53 0.21
54 0.21
55 0.22
56 0.21
57 0.2
58 0.21
59 0.22
60 0.21
61 0.17
62 0.17
63 0.18
64 0.19
65 0.21
66 0.19
67 0.18
68 0.14
69 0.13
70 0.14
71 0.13
72 0.12
73 0.11
74 0.13
75 0.13
76 0.13
77 0.12
78 0.1
79 0.11
80 0.12
81 0.12
82 0.12
83 0.12
84 0.12
85 0.17
86 0.23
87 0.27
88 0.29
89 0.35
90 0.37
91 0.41
92 0.42
93 0.4
94 0.37
95 0.33
96 0.33