Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V2JWU3

Protein Details
Accession A0A4V2JWU3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
161-192FMPNIWERKIPRKKRIVGKGRKDPKKAQCIALHydrophilic
NLS Segment(s)
PositionSequence
157-186KRRGFMPNIWERKIPRKKRIVGKGRKDPKK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 4, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MINNFNSEETDLIFAIRMCLEKCYEYKITTQHLFVDYNWRRRLIVQYLIDTQYLAYAENLAIVDTKQEDIESTLRILAAESGKAGLKINEVKTKYILMSSVYEYPRNSLKIGSYIFERVSSFKYLGSAKSKYEKAKYKTIIRLVVLYASETLDMTKKRRGFMPNIWERKIPRKKRIVGKGRKDPKKAQCIALEKLGEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.12
5 0.11
6 0.13
7 0.15
8 0.17
9 0.19
10 0.24
11 0.26
12 0.26
13 0.3
14 0.33
15 0.38
16 0.37
17 0.37
18 0.34
19 0.33
20 0.32
21 0.29
22 0.35
23 0.35
24 0.41
25 0.42
26 0.4
27 0.38
28 0.39
29 0.46
30 0.4
31 0.42
32 0.36
33 0.37
34 0.39
35 0.4
36 0.37
37 0.3
38 0.24
39 0.17
40 0.14
41 0.11
42 0.07
43 0.06
44 0.06
45 0.07
46 0.07
47 0.06
48 0.06
49 0.05
50 0.06
51 0.06
52 0.07
53 0.06
54 0.06
55 0.06
56 0.08
57 0.1
58 0.1
59 0.09
60 0.09
61 0.09
62 0.09
63 0.09
64 0.08
65 0.08
66 0.07
67 0.06
68 0.07
69 0.07
70 0.08
71 0.08
72 0.06
73 0.09
74 0.13
75 0.16
76 0.21
77 0.22
78 0.22
79 0.23
80 0.23
81 0.21
82 0.17
83 0.14
84 0.1
85 0.1
86 0.11
87 0.16
88 0.16
89 0.17
90 0.17
91 0.18
92 0.19
93 0.19
94 0.17
95 0.13
96 0.13
97 0.15
98 0.16
99 0.15
100 0.14
101 0.14
102 0.14
103 0.14
104 0.14
105 0.12
106 0.14
107 0.15
108 0.14
109 0.12
110 0.15
111 0.15
112 0.18
113 0.22
114 0.21
115 0.22
116 0.28
117 0.32
118 0.35
119 0.42
120 0.47
121 0.47
122 0.54
123 0.58
124 0.6
125 0.63
126 0.64
127 0.6
128 0.51
129 0.48
130 0.39
131 0.35
132 0.26
133 0.2
134 0.15
135 0.11
136 0.1
137 0.08
138 0.09
139 0.11
140 0.14
141 0.16
142 0.23
143 0.26
144 0.28
145 0.34
146 0.39
147 0.42
148 0.48
149 0.56
150 0.59
151 0.63
152 0.64
153 0.62
154 0.61
155 0.65
156 0.67
157 0.66
158 0.65
159 0.68
160 0.75
161 0.81
162 0.88
163 0.88
164 0.88
165 0.89
166 0.9
167 0.9
168 0.91
169 0.88
170 0.87
171 0.86
172 0.86
173 0.8
174 0.76
175 0.74
176 0.71
177 0.67
178 0.64