Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LHQ4

Protein Details
Accession A0A4Q9LHQ4   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MQRKYNNSKNKKNVDKTDENIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019012  RNA_cap_Gua-N2-MeTrfase  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0009452  P:7-methylguanosine RNA capping  
GO:0001510  P:RNA methylation  
Pfam View protein in Pfam  
PF09445  Methyltransf_15  
Amino Acid Sequences MQRKYNNSKNKKNVDKTDENINKQKKNQRGYYIYQKYNDWIITDYSLQKNREISKFYYRRHFLFSKIESGIIMDYESWFSVTPEFLVKKVINIFNQLLNSKKEVICGYCGVGGDTVVFLKHGFDVYACDILYSKIKYLKINSSIYKKEQDKKYIYGNLSCEVSDFLTLNVDRKYEYGFLSPPWGGMDYKNSALFDLYSIDFDKITTKSQSIIKNCVYFLPKNCNPRQIEDIIKDSITVNIMFQERILGLVVFHGDDFLANKEAICLAFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.86
3 0.78
4 0.79
5 0.77
6 0.73
7 0.73
8 0.72
9 0.69
10 0.69
11 0.75
12 0.73
13 0.74
14 0.74
15 0.74
16 0.73
17 0.73
18 0.76
19 0.77
20 0.73
21 0.66
22 0.6
23 0.53
24 0.5
25 0.44
26 0.34
27 0.26
28 0.22
29 0.22
30 0.23
31 0.26
32 0.28
33 0.33
34 0.33
35 0.34
36 0.38
37 0.42
38 0.44
39 0.43
40 0.41
41 0.46
42 0.53
43 0.55
44 0.6
45 0.58
46 0.55
47 0.58
48 0.55
49 0.49
50 0.49
51 0.47
52 0.42
53 0.39
54 0.37
55 0.29
56 0.28
57 0.23
58 0.14
59 0.12
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.11
71 0.12
72 0.12
73 0.16
74 0.15
75 0.17
76 0.22
77 0.26
78 0.22
79 0.26
80 0.27
81 0.25
82 0.27
83 0.25
84 0.23
85 0.21
86 0.22
87 0.21
88 0.2
89 0.19
90 0.19
91 0.19
92 0.18
93 0.17
94 0.16
95 0.14
96 0.14
97 0.12
98 0.1
99 0.09
100 0.07
101 0.06
102 0.05
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.06
112 0.08
113 0.09
114 0.08
115 0.08
116 0.08
117 0.09
118 0.11
119 0.1
120 0.1
121 0.13
122 0.15
123 0.17
124 0.2
125 0.24
126 0.27
127 0.31
128 0.34
129 0.36
130 0.37
131 0.38
132 0.42
133 0.42
134 0.45
135 0.46
136 0.5
137 0.48
138 0.48
139 0.52
140 0.51
141 0.47
142 0.42
143 0.38
144 0.32
145 0.28
146 0.25
147 0.19
148 0.14
149 0.13
150 0.1
151 0.08
152 0.07
153 0.09
154 0.09
155 0.11
156 0.11
157 0.11
158 0.11
159 0.11
160 0.13
161 0.12
162 0.13
163 0.13
164 0.13
165 0.14
166 0.17
167 0.17
168 0.15
169 0.14
170 0.14
171 0.12
172 0.12
173 0.16
174 0.15
175 0.17
176 0.19
177 0.18
178 0.17
179 0.16
180 0.16
181 0.12
182 0.11
183 0.1
184 0.1
185 0.11
186 0.11
187 0.1
188 0.11
189 0.13
190 0.12
191 0.15
192 0.16
193 0.16
194 0.19
195 0.25
196 0.32
197 0.33
198 0.39
199 0.4
200 0.4
201 0.4
202 0.41
203 0.4
204 0.37
205 0.38
206 0.41
207 0.42
208 0.49
209 0.53
210 0.57
211 0.55
212 0.56
213 0.56
214 0.51
215 0.52
216 0.47
217 0.47
218 0.4
219 0.37
220 0.33
221 0.27
222 0.24
223 0.19
224 0.15
225 0.11
226 0.13
227 0.14
228 0.14
229 0.13
230 0.14
231 0.12
232 0.12
233 0.13
234 0.09
235 0.08
236 0.09
237 0.1
238 0.09
239 0.08
240 0.08
241 0.06
242 0.07
243 0.09
244 0.11
245 0.12
246 0.12
247 0.12
248 0.13
249 0.14