Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LDE4

Protein Details
Accession A0A4Q9LDE4   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
142-178DKNVSESEKRRKESKKRSKESKDIKKLRKIRNVTLLKBasic
NLS Segment(s)
PositionSequence
150-172KRRKESKKRSKESKDIKKLRKIR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012173  Mpp10  
Gene Ontology GO:0034457  C:Mpp10 complex  
GO:0005732  C:sno(s)RNA-containing ribonucleoprotein complex  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04006  Mpp10  
Amino Acid Sequences MTFEENEFTDWKYKGEVEGRERPKGSLINQEIQFDQTKPLIPILEENFDIRKVVIERIKERKYDNWILQKKEENINEGIEDNEENKDITNIEDDNLSKEEMRELFSLIDKQLLQITDYKLLFCNSLFFKEELIKNENEINFDKNVSESEKRRKESKKRSKESKDIKKLRKIRNVTLLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.3
3 0.35
4 0.38
5 0.47
6 0.52
7 0.56
8 0.56
9 0.51
10 0.49
11 0.46
12 0.41
13 0.42
14 0.42
15 0.43
16 0.44
17 0.45
18 0.4
19 0.38
20 0.37
21 0.27
22 0.25
23 0.18
24 0.19
25 0.18
26 0.19
27 0.16
28 0.15
29 0.19
30 0.19
31 0.2
32 0.19
33 0.19
34 0.19
35 0.18
36 0.18
37 0.13
38 0.13
39 0.12
40 0.17
41 0.2
42 0.24
43 0.3
44 0.39
45 0.43
46 0.42
47 0.44
48 0.44
49 0.48
50 0.5
51 0.5
52 0.52
53 0.54
54 0.55
55 0.56
56 0.56
57 0.51
58 0.5
59 0.44
60 0.37
61 0.32
62 0.29
63 0.26
64 0.21
65 0.18
66 0.12
67 0.11
68 0.08
69 0.07
70 0.07
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.07
77 0.06
78 0.06
79 0.08
80 0.08
81 0.09
82 0.1
83 0.1
84 0.09
85 0.09
86 0.11
87 0.1
88 0.12
89 0.11
90 0.11
91 0.11
92 0.12
93 0.13
94 0.11
95 0.13
96 0.1
97 0.1
98 0.11
99 0.11
100 0.11
101 0.13
102 0.15
103 0.18
104 0.18
105 0.18
106 0.17
107 0.18
108 0.18
109 0.14
110 0.16
111 0.13
112 0.15
113 0.17
114 0.16
115 0.17
116 0.22
117 0.25
118 0.26
119 0.28
120 0.26
121 0.25
122 0.3
123 0.29
124 0.27
125 0.26
126 0.24
127 0.21
128 0.21
129 0.2
130 0.16
131 0.17
132 0.19
133 0.24
134 0.29
135 0.39
136 0.47
137 0.51
138 0.59
139 0.68
140 0.73
141 0.78
142 0.82
143 0.82
144 0.84
145 0.92
146 0.93
147 0.93
148 0.93
149 0.93
150 0.93
151 0.92
152 0.91
153 0.91
154 0.91
155 0.91
156 0.9
157 0.86
158 0.84