Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9L9Z8

Protein Details
Accession A0A4Q9L9Z8   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
30-49LFHCIESKRNYQKNKSNKIFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004882  Luc7-rel  
Gene Ontology GO:0005685  C:U1 snRNP  
GO:0003729  F:mRNA binding  
GO:0006376  P:mRNA splice site selection  
Pfam View protein in Pfam  
PF03194  LUC7  
Amino Acid Sequences MNSKKCEEYIVADCTKTIFYIEGFTIPCNLFHCIESKRNYQKNKSNKIFPYESSVYQNICKIITDIDRKISMNKKLLRNLNAGTKYKKYENAINECEKIFICEHEKENNYKELHNLLSIHGTLILEMEELKDEPAINLSVCDVCSAICVKREICKHGFHDSYKMLRIKQKELENRLTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.2
4 0.16
5 0.1
6 0.09
7 0.12
8 0.13
9 0.14
10 0.15
11 0.15
12 0.17
13 0.17
14 0.17
15 0.17
16 0.19
17 0.17
18 0.17
19 0.21
20 0.23
21 0.29
22 0.33
23 0.4
24 0.48
25 0.54
26 0.62
27 0.66
28 0.71
29 0.75
30 0.81
31 0.78
32 0.77
33 0.73
34 0.73
35 0.66
36 0.58
37 0.56
38 0.48
39 0.43
40 0.39
41 0.36
42 0.3
43 0.28
44 0.29
45 0.21
46 0.18
47 0.16
48 0.12
49 0.13
50 0.17
51 0.21
52 0.21
53 0.23
54 0.24
55 0.24
56 0.29
57 0.33
58 0.33
59 0.35
60 0.4
61 0.43
62 0.48
63 0.54
64 0.51
65 0.49
66 0.45
67 0.45
68 0.44
69 0.41
70 0.37
71 0.34
72 0.34
73 0.32
74 0.34
75 0.29
76 0.3
77 0.34
78 0.38
79 0.39
80 0.39
81 0.38
82 0.34
83 0.32
84 0.26
85 0.22
86 0.15
87 0.13
88 0.14
89 0.16
90 0.18
91 0.23
92 0.25
93 0.26
94 0.29
95 0.33
96 0.3
97 0.28
98 0.27
99 0.24
100 0.23
101 0.22
102 0.2
103 0.14
104 0.15
105 0.14
106 0.13
107 0.11
108 0.1
109 0.08
110 0.07
111 0.06
112 0.04
113 0.04
114 0.05
115 0.05
116 0.05
117 0.06
118 0.06
119 0.06
120 0.06
121 0.08
122 0.08
123 0.08
124 0.07
125 0.08
126 0.09
127 0.09
128 0.09
129 0.07
130 0.06
131 0.08
132 0.1
133 0.11
134 0.13
135 0.16
136 0.17
137 0.24
138 0.29
139 0.34
140 0.36
141 0.41
142 0.42
143 0.49
144 0.53
145 0.49
146 0.51
147 0.5
148 0.51
149 0.51
150 0.51
151 0.47
152 0.49
153 0.52
154 0.53
155 0.55
156 0.6
157 0.62
158 0.66