Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M5Q3

Protein Details
Accession E2M5Q3   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
109-129ISLHRASRKVRDRRRTGALDRBasic
NLS Segment(s)
Subcellular Location(s) mito 8, cyto_nucl 7, nucl 6.5, cyto 6.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
KEGG mpr:MPER_15860  -  
Amino Acid Sequences PTPPKATSPNYILYANAIHSVVDEAGSNFVGFLLNGLVGDFPPESDSMVVSIFRSMSSTWPAQMLSWMPSILQQLPTTAAPIPIKEQFLNQLSSAINEKRFDQVKYAVISLHRASRKVRDRRRTGALDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.23
3 0.2
4 0.15
5 0.11
6 0.11
7 0.12
8 0.1
9 0.09
10 0.08
11 0.07
12 0.08
13 0.08
14 0.08
15 0.06
16 0.06
17 0.06
18 0.05
19 0.05
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.06
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.07
34 0.06
35 0.07
36 0.07
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.06
43 0.07
44 0.11
45 0.11
46 0.11
47 0.11
48 0.11
49 0.1
50 0.11
51 0.1
52 0.09
53 0.09
54 0.08
55 0.08
56 0.09
57 0.11
58 0.1
59 0.11
60 0.1
61 0.1
62 0.12
63 0.12
64 0.12
65 0.1
66 0.12
67 0.11
68 0.12
69 0.14
70 0.15
71 0.17
72 0.16
73 0.17
74 0.19
75 0.21
76 0.22
77 0.19
78 0.19
79 0.17
80 0.18
81 0.22
82 0.19
83 0.2
84 0.19
85 0.2
86 0.25
87 0.28
88 0.27
89 0.27
90 0.28
91 0.3
92 0.31
93 0.3
94 0.26
95 0.24
96 0.28
97 0.26
98 0.3
99 0.28
100 0.29
101 0.32
102 0.4
103 0.49
104 0.56
105 0.65
106 0.67
107 0.73
108 0.78
109 0.84