Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LHS4

Protein Details
Accession E2LHS4   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
2-29VKARPAKTTGNQKKKGFKRNRDSRVSASHydrophilic
NLS Segment(s)
PositionSequence
7-36AKTTGNQKKKGFKRNRDSRVSASESRRLKR
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG mpr:MPER_06067  -  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MVKARPAKTTGNQKKKGFKRNRDSRVSASESRRLKRIAERNAATTCFVCREKGHSAKDCLKSGGTEEGNQKRSLGICY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.85
4 0.84
5 0.84
6 0.84
7 0.86
8 0.88
9 0.86
10 0.82
11 0.76
12 0.72
13 0.68
14 0.64
15 0.57
16 0.56
17 0.53
18 0.5
19 0.48
20 0.42
21 0.38
22 0.4
23 0.45
24 0.45
25 0.47
26 0.47
27 0.47
28 0.47
29 0.46
30 0.38
31 0.29
32 0.22
33 0.18
34 0.17
35 0.15
36 0.14
37 0.19
38 0.26
39 0.33
40 0.39
41 0.4
42 0.46
43 0.53
44 0.58
45 0.55
46 0.49
47 0.42
48 0.36
49 0.33
50 0.35
51 0.28
52 0.27
53 0.33
54 0.4
55 0.42
56 0.42
57 0.4
58 0.34