Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L7G7

Protein Details
Accession E2L7G7   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26CPSYYKPRPPRKSKPKPKTISSNEQLHydrophilic
NLS Segment(s)
PositionSequence
6-18KPRPPRKSKPKPK
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 8
Family & Domain DBs
KEGG mpr:MPER_01824  -  
Amino Acid Sequences CPSYYKPRPPRKSKPKPKTISSNEQLVQDLHSVQKTVNVIASYIIPDPNLLASIPSRALPAIVSANPLHAADSMSSLAALPAQSFPLPTVDVFQLPGAANTAIFNGRRPKSAHIHQTRAQQWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.94
3 0.92
4 0.9
5 0.9
6 0.87
7 0.86
8 0.78
9 0.76
10 0.66
11 0.59
12 0.52
13 0.41
14 0.34
15 0.24
16 0.21
17 0.15
18 0.14
19 0.12
20 0.11
21 0.15
22 0.14
23 0.13
24 0.14
25 0.12
26 0.12
27 0.12
28 0.13
29 0.1
30 0.1
31 0.1
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.05
38 0.05
39 0.05
40 0.06
41 0.07
42 0.07
43 0.07
44 0.06
45 0.07
46 0.06
47 0.07
48 0.07
49 0.07
50 0.09
51 0.08
52 0.09
53 0.09
54 0.09
55 0.08
56 0.07
57 0.08
58 0.06
59 0.07
60 0.07
61 0.06
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.04
68 0.05
69 0.06
70 0.06
71 0.06
72 0.07
73 0.08
74 0.09
75 0.08
76 0.11
77 0.11
78 0.11
79 0.12
80 0.11
81 0.12
82 0.11
83 0.11
84 0.11
85 0.1
86 0.09
87 0.09
88 0.1
89 0.11
90 0.11
91 0.16
92 0.23
93 0.25
94 0.29
95 0.32
96 0.37
97 0.43
98 0.52
99 0.59
100 0.59
101 0.65
102 0.66
103 0.73