Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q2CZL8

Protein Details
Accession A0A4Q2CZL8    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-36LDTPSTRRQKSLKKKAEKRKSAASAGHydrophilic
229-248STPSINQRWKNPKVRAECRAHydrophilic
NLS Segment(s)
PositionSequence
17-31RRQKSLKKKAEKRKS
152-160QAKRVRGKR
Subcellular Location(s) nucl 17, cyto_nucl 12, mito 5, cyto 5
Family & Domain DBs
Amino Acid Sequences DASGRVVIEELDTPSTRRQKSLKKKAEKRKSAASAGEAPSASGLVRIIEQGTTVGEPEGEMMIMSSPAPPPISAGGPSTPAPTSASAVAGPPSLSSYVPGASKQQGDSNEDMDSESELSELSELPSEVASSQRDGVVPDEEEEPAPKKTPLQAKRVRGKRRLMELYDSGTLVWAKADDILTQFKETRSRRKMKLYIVRFYDRGSTWAYLGREKLKMLGEDDKLDNDMISTPSINQRWKNPKVRAECRAAYRKAYGEMESKTDADADADGEPEEEGNATDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.35
3 0.35
4 0.39
5 0.46
6 0.53
7 0.64
8 0.73
9 0.75
10 0.78
11 0.87
12 0.92
13 0.94
14 0.94
15 0.89
16 0.88
17 0.85
18 0.79
19 0.72
20 0.66
21 0.63
22 0.55
23 0.51
24 0.4
25 0.33
26 0.27
27 0.24
28 0.18
29 0.11
30 0.09
31 0.06
32 0.06
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.08
40 0.08
41 0.07
42 0.06
43 0.06
44 0.07
45 0.06
46 0.05
47 0.05
48 0.04
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.07
55 0.08
56 0.08
57 0.09
58 0.11
59 0.12
60 0.12
61 0.13
62 0.13
63 0.15
64 0.15
65 0.16
66 0.14
67 0.14
68 0.14
69 0.13
70 0.14
71 0.12
72 0.12
73 0.11
74 0.11
75 0.11
76 0.09
77 0.08
78 0.07
79 0.07
80 0.08
81 0.07
82 0.08
83 0.08
84 0.09
85 0.1
86 0.11
87 0.12
88 0.14
89 0.15
90 0.15
91 0.18
92 0.18
93 0.22
94 0.22
95 0.21
96 0.18
97 0.17
98 0.16
99 0.13
100 0.11
101 0.08
102 0.07
103 0.05
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.05
113 0.05
114 0.05
115 0.07
116 0.07
117 0.07
118 0.08
119 0.08
120 0.08
121 0.09
122 0.1
123 0.09
124 0.09
125 0.09
126 0.1
127 0.09
128 0.09
129 0.1
130 0.1
131 0.1
132 0.11
133 0.1
134 0.1
135 0.15
136 0.24
137 0.3
138 0.38
139 0.45
140 0.52
141 0.62
142 0.7
143 0.74
144 0.72
145 0.73
146 0.69
147 0.7
148 0.67
149 0.6
150 0.56
151 0.49
152 0.45
153 0.37
154 0.32
155 0.22
156 0.17
157 0.15
158 0.1
159 0.08
160 0.05
161 0.04
162 0.06
163 0.06
164 0.06
165 0.08
166 0.11
167 0.12
168 0.14
169 0.15
170 0.15
171 0.24
172 0.27
173 0.36
174 0.43
175 0.5
176 0.54
177 0.63
178 0.68
179 0.69
180 0.75
181 0.71
182 0.69
183 0.67
184 0.65
185 0.56
186 0.51
187 0.45
188 0.36
189 0.31
190 0.27
191 0.22
192 0.18
193 0.23
194 0.23
195 0.21
196 0.24
197 0.26
198 0.24
199 0.24
200 0.26
201 0.24
202 0.24
203 0.25
204 0.29
205 0.27
206 0.28
207 0.29
208 0.26
209 0.25
210 0.23
211 0.19
212 0.13
213 0.13
214 0.1
215 0.1
216 0.1
217 0.11
218 0.18
219 0.23
220 0.28
221 0.3
222 0.39
223 0.48
224 0.57
225 0.65
226 0.67
227 0.71
228 0.76
229 0.81
230 0.79
231 0.77
232 0.73
233 0.73
234 0.74
235 0.68
236 0.62
237 0.57
238 0.53
239 0.5
240 0.47
241 0.41
242 0.37
243 0.36
244 0.36
245 0.34
246 0.32
247 0.26
248 0.24
249 0.21
250 0.16
251 0.14
252 0.12
253 0.09
254 0.1
255 0.09
256 0.09
257 0.09
258 0.08
259 0.08
260 0.07