Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q2DFW1

Protein Details
Accession A0A4Q2DFW1    Localization Confidence High Confidence Score 20.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-48TEAQRVKREKAAERQRRKRERDRAQAQTQAQHydrophilic
264-304RWNSQLKYKPNSNHSRKRKRLRNNQHPPKRNLNLNLRHRPNHydrophilic
NLS Segment(s)
PositionSequence
10-39RKRPRENETEAQRVKREKAAERQRRKRERD
143-166RRDKVRASARERQRKHRALVKERK
277-293HSRKRKRLRNNQHPPKR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MDEQTAANPRKRPRENETEAQRVKREKAAERQRRKRERDRAQAQTQAQLEAQQQQQAEEYAQAQAQAQAQAQAQAQQVQQVVVSAAGIGMLYASPDQQHLLQSHPLPHQLVHPQSISMAANMNGYQEQDEAGQPHLSREEADRRDKVRASARERQRKHRALVKERKMRDMGMEMGDDDIGDVDEAMRYQPGQYALTSDLQHSIPILEPTFTGVGQGLGGQTFASTLLLSFSCAPLLKAHLLRTLNMTNEELASLEPVIADAWDRWNSQLKYKPNSNHSRKRKRLRNNQHPPKRNLNLNLRHRPNHNSNLRQARPQITLLRLPLLTPMDLTLVPWTFETASRIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.75
3 0.78
4 0.79
5 0.79
6 0.77
7 0.74
8 0.72
9 0.67
10 0.63
11 0.59
12 0.58
13 0.55
14 0.6
15 0.66
16 0.7
17 0.76
18 0.82
19 0.87
20 0.91
21 0.92
22 0.92
23 0.92
24 0.92
25 0.92
26 0.91
27 0.89
28 0.86
29 0.85
30 0.76
31 0.72
32 0.62
33 0.52
34 0.43
35 0.36
36 0.31
37 0.28
38 0.28
39 0.24
40 0.23
41 0.22
42 0.23
43 0.2
44 0.19
45 0.14
46 0.14
47 0.12
48 0.12
49 0.12
50 0.11
51 0.12
52 0.14
53 0.14
54 0.13
55 0.15
56 0.15
57 0.17
58 0.17
59 0.19
60 0.18
61 0.2
62 0.19
63 0.2
64 0.2
65 0.17
66 0.17
67 0.13
68 0.12
69 0.08
70 0.08
71 0.05
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.02
78 0.03
79 0.03
80 0.04
81 0.04
82 0.05
83 0.06
84 0.07
85 0.11
86 0.11
87 0.14
88 0.18
89 0.19
90 0.24
91 0.24
92 0.26
93 0.24
94 0.24
95 0.25
96 0.27
97 0.27
98 0.25
99 0.24
100 0.21
101 0.2
102 0.22
103 0.18
104 0.12
105 0.11
106 0.09
107 0.1
108 0.1
109 0.1
110 0.08
111 0.08
112 0.08
113 0.07
114 0.07
115 0.07
116 0.08
117 0.08
118 0.09
119 0.11
120 0.1
121 0.11
122 0.11
123 0.1
124 0.1
125 0.13
126 0.21
127 0.24
128 0.29
129 0.33
130 0.34
131 0.38
132 0.39
133 0.39
134 0.39
135 0.43
136 0.45
137 0.5
138 0.58
139 0.64
140 0.67
141 0.72
142 0.74
143 0.72
144 0.69
145 0.67
146 0.67
147 0.67
148 0.74
149 0.74
150 0.72
151 0.68
152 0.68
153 0.61
154 0.52
155 0.43
156 0.35
157 0.26
158 0.19
159 0.17
160 0.13
161 0.11
162 0.11
163 0.09
164 0.06
165 0.04
166 0.03
167 0.03
168 0.02
169 0.02
170 0.02
171 0.03
172 0.03
173 0.03
174 0.03
175 0.04
176 0.06
177 0.07
178 0.08
179 0.08
180 0.1
181 0.12
182 0.15
183 0.15
184 0.13
185 0.14
186 0.13
187 0.13
188 0.11
189 0.1
190 0.08
191 0.09
192 0.09
193 0.07
194 0.07
195 0.09
196 0.09
197 0.08
198 0.08
199 0.07
200 0.06
201 0.06
202 0.06
203 0.05
204 0.04
205 0.04
206 0.04
207 0.03
208 0.04
209 0.04
210 0.04
211 0.03
212 0.03
213 0.05
214 0.05
215 0.06
216 0.07
217 0.07
218 0.08
219 0.08
220 0.09
221 0.08
222 0.11
223 0.15
224 0.16
225 0.18
226 0.23
227 0.23
228 0.23
229 0.27
230 0.27
231 0.24
232 0.24
233 0.23
234 0.18
235 0.17
236 0.17
237 0.12
238 0.09
239 0.09
240 0.07
241 0.06
242 0.05
243 0.05
244 0.05
245 0.04
246 0.05
247 0.05
248 0.09
249 0.12
250 0.13
251 0.15
252 0.24
253 0.25
254 0.32
255 0.4
256 0.43
257 0.48
258 0.56
259 0.61
260 0.62
261 0.72
262 0.75
263 0.78
264 0.81
265 0.85
266 0.88
267 0.92
268 0.92
269 0.92
270 0.93
271 0.94
272 0.94
273 0.94
274 0.95
275 0.95
276 0.95
277 0.9
278 0.9
279 0.85
280 0.82
281 0.8
282 0.79
283 0.78
284 0.79
285 0.82
286 0.79
287 0.77
288 0.73
289 0.73
290 0.71
291 0.71
292 0.71
293 0.67
294 0.69
295 0.75
296 0.74
297 0.72
298 0.69
299 0.64
300 0.58
301 0.56
302 0.53
303 0.47
304 0.49
305 0.44
306 0.42
307 0.36
308 0.33
309 0.32
310 0.28
311 0.24
312 0.19
313 0.18
314 0.16
315 0.16
316 0.17
317 0.17
318 0.15
319 0.16
320 0.15
321 0.17
322 0.15
323 0.17