Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q2DRB7

Protein Details
Accession A0A4Q2DRB7    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
77-97GPSGPARTKRRERPVTAPYKYHydrophilic
NLS Segment(s)
PositionSequence
82-111ARTKRRERPVTAPYKYGKHRSEPGGQRPTK
206-247RRAQKRAERARQKAQEEEEQRRRLHQEKEARRRRWEEQRRRE
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MSPTPKEAAARHRPNPIIRYPMKLLGLYESSEDVITQAFDPRSIQRPNIFAGRTPITRAAPVKTAGPSSSIRCDAAGPSGPARTKRRERPVTAPYKYGKHRSEPGGQRPTKLRRSSSLASSSLANRSFDSGLSLTSRPEEREPPIDFVEARDRTRQFMEEYPDKVTEDDRVFYREMCKHAQKQEFEQQLQDLRELHNKPPIDFEQRRAQKRAERARQKAQEEEEQRRRLHQEKEARRRRWEEQRRREEEEEVARLRKEEEEREQQRRKEQLEELCRRNEEKEAALLRKEEREREEQQRHREEMEEMGRLTLEKQAYLQRAEAELRSKEEDLRAQEDKLEAERWQRRQQEEEAQKLLIGRLKVLQERERAAEVARVQAVFDKRARQLDAQLRGSVQFPQQLSRKEPSFYPMEVDEELLINKAAPQQHDHHPLYTPPPHPLHYHSQIHSGITN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.7
3 0.67
4 0.66
5 0.59
6 0.61
7 0.57
8 0.57
9 0.52
10 0.46
11 0.41
12 0.35
13 0.35
14 0.28
15 0.25
16 0.2
17 0.18
18 0.17
19 0.16
20 0.11
21 0.1
22 0.1
23 0.09
24 0.14
25 0.13
26 0.14
27 0.17
28 0.21
29 0.28
30 0.31
31 0.36
32 0.34
33 0.37
34 0.4
35 0.45
36 0.41
37 0.36
38 0.38
39 0.39
40 0.35
41 0.37
42 0.38
43 0.32
44 0.36
45 0.37
46 0.34
47 0.32
48 0.32
49 0.32
50 0.29
51 0.29
52 0.24
53 0.26
54 0.25
55 0.26
56 0.3
57 0.29
58 0.27
59 0.25
60 0.26
61 0.23
62 0.25
63 0.24
64 0.21
65 0.2
66 0.25
67 0.27
68 0.33
69 0.39
70 0.44
71 0.5
72 0.58
73 0.67
74 0.72
75 0.75
76 0.77
77 0.81
78 0.82
79 0.75
80 0.72
81 0.65
82 0.63
83 0.64
84 0.64
85 0.58
86 0.54
87 0.58
88 0.57
89 0.63
90 0.64
91 0.67
92 0.69
93 0.66
94 0.64
95 0.65
96 0.68
97 0.67
98 0.65
99 0.58
100 0.53
101 0.6
102 0.59
103 0.57
104 0.54
105 0.46
106 0.4
107 0.39
108 0.35
109 0.33
110 0.31
111 0.25
112 0.19
113 0.21
114 0.2
115 0.18
116 0.19
117 0.14
118 0.13
119 0.15
120 0.15
121 0.13
122 0.15
123 0.17
124 0.16
125 0.19
126 0.22
127 0.23
128 0.29
129 0.31
130 0.32
131 0.32
132 0.31
133 0.28
134 0.26
135 0.32
136 0.28
137 0.28
138 0.31
139 0.3
140 0.31
141 0.33
142 0.32
143 0.26
144 0.27
145 0.32
146 0.3
147 0.32
148 0.32
149 0.31
150 0.3
151 0.27
152 0.23
153 0.21
154 0.18
155 0.18
156 0.16
157 0.18
158 0.18
159 0.18
160 0.23
161 0.22
162 0.24
163 0.28
164 0.33
165 0.37
166 0.45
167 0.5
168 0.47
169 0.49
170 0.54
171 0.54
172 0.48
173 0.43
174 0.36
175 0.34
176 0.33
177 0.28
178 0.2
179 0.16
180 0.23
181 0.24
182 0.25
183 0.26
184 0.26
185 0.25
186 0.29
187 0.3
188 0.32
189 0.32
190 0.34
191 0.38
192 0.46
193 0.5
194 0.48
195 0.48
196 0.44
197 0.52
198 0.59
199 0.59
200 0.61
201 0.63
202 0.7
203 0.73
204 0.7
205 0.65
206 0.57
207 0.55
208 0.51
209 0.54
210 0.52
211 0.5
212 0.48
213 0.46
214 0.47
215 0.45
216 0.44
217 0.43
218 0.45
219 0.5
220 0.61
221 0.69
222 0.69
223 0.69
224 0.7
225 0.7
226 0.71
227 0.72
228 0.72
229 0.73
230 0.79
231 0.78
232 0.8
233 0.74
234 0.65
235 0.59
236 0.52
237 0.45
238 0.37
239 0.32
240 0.26
241 0.24
242 0.23
243 0.22
244 0.2
245 0.2
246 0.25
247 0.34
248 0.4
249 0.5
250 0.56
251 0.55
252 0.59
253 0.61
254 0.56
255 0.51
256 0.5
257 0.49
258 0.53
259 0.57
260 0.54
261 0.51
262 0.51
263 0.47
264 0.42
265 0.37
266 0.29
267 0.23
268 0.25
269 0.26
270 0.26
271 0.26
272 0.27
273 0.25
274 0.3
275 0.31
276 0.29
277 0.29
278 0.34
279 0.39
280 0.47
281 0.56
282 0.56
283 0.63
284 0.66
285 0.63
286 0.57
287 0.53
288 0.44
289 0.4
290 0.36
291 0.29
292 0.22
293 0.2
294 0.19
295 0.17
296 0.17
297 0.15
298 0.12
299 0.1
300 0.12
301 0.17
302 0.2
303 0.21
304 0.22
305 0.19
306 0.21
307 0.22
308 0.22
309 0.21
310 0.2
311 0.22
312 0.24
313 0.23
314 0.23
315 0.24
316 0.27
317 0.26
318 0.3
319 0.29
320 0.26
321 0.27
322 0.26
323 0.25
324 0.22
325 0.2
326 0.17
327 0.24
328 0.32
329 0.37
330 0.44
331 0.5
332 0.51
333 0.54
334 0.58
335 0.59
336 0.59
337 0.59
338 0.53
339 0.46
340 0.43
341 0.39
342 0.35
343 0.28
344 0.21
345 0.15
346 0.17
347 0.21
348 0.25
349 0.3
350 0.33
351 0.34
352 0.37
353 0.39
354 0.37
355 0.34
356 0.31
357 0.3
358 0.25
359 0.25
360 0.23
361 0.2
362 0.18
363 0.23
364 0.25
365 0.25
366 0.27
367 0.29
368 0.31
369 0.36
370 0.4
371 0.36
372 0.43
373 0.47
374 0.53
375 0.5
376 0.47
377 0.43
378 0.4
379 0.39
380 0.33
381 0.27
382 0.24
383 0.22
384 0.27
385 0.33
386 0.37
387 0.42
388 0.45
389 0.45
390 0.42
391 0.42
392 0.4
393 0.39
394 0.34
395 0.33
396 0.27
397 0.28
398 0.26
399 0.26
400 0.22
401 0.18
402 0.17
403 0.14
404 0.12
405 0.09
406 0.1
407 0.14
408 0.16
409 0.18
410 0.23
411 0.27
412 0.36
413 0.46
414 0.47
415 0.45
416 0.44
417 0.46
418 0.48
419 0.51
420 0.45
421 0.43
422 0.44
423 0.45
424 0.46
425 0.48
426 0.5
427 0.51
428 0.56
429 0.51
430 0.54
431 0.53