Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q2DU74

Protein Details
Accession A0A4Q2DU74    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
68-91IDERLRRERENEKKKKRPVKLLLLBasic
NLS Segment(s)
PositionSequence
72-86LRRERENEKKKKRPV
Subcellular Location(s) nucl 18, cyto 6.5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001019  Gprotein_alpha_su  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0031683  F:G-protein beta/gamma-subunit complex binding  
GO:0003924  F:GTPase activity  
GO:0019001  F:guanyl nucleotide binding  
GO:0007186  P:G protein-coupled receptor signaling pathway  
Pfam View protein in Pfam  
PF00503  G-alpha  
Amino Acid Sequences MSTCREICDSVISINVKPNPEPRGSARPTLPEVDPLAAWTAAPPDETPEQRVIREAAEAEAKKISDEIDERLRRERENEKKKKRPVKLLLLGQSESGKTATLKNFQLTYARREWAEERAAWRSVIFLNFVRNVNLVSDHLNAEMSDYPVVNHDESQEDLSSRARPFLASSSPMSIVDSGQVSPSSLKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.29
4 0.3
5 0.35
6 0.34
7 0.35
8 0.38
9 0.38
10 0.44
11 0.46
12 0.49
13 0.46
14 0.46
15 0.47
16 0.46
17 0.4
18 0.34
19 0.32
20 0.27
21 0.24
22 0.2
23 0.18
24 0.14
25 0.13
26 0.1
27 0.1
28 0.09
29 0.1
30 0.09
31 0.11
32 0.16
33 0.17
34 0.2
35 0.24
36 0.25
37 0.25
38 0.27
39 0.24
40 0.2
41 0.2
42 0.17
43 0.12
44 0.18
45 0.18
46 0.17
47 0.17
48 0.17
49 0.15
50 0.15
51 0.14
52 0.1
53 0.11
54 0.13
55 0.22
56 0.24
57 0.26
58 0.32
59 0.33
60 0.31
61 0.35
62 0.42
63 0.43
64 0.52
65 0.61
66 0.66
67 0.74
68 0.83
69 0.87
70 0.84
71 0.84
72 0.81
73 0.8
74 0.77
75 0.73
76 0.69
77 0.62
78 0.55
79 0.45
80 0.37
81 0.27
82 0.2
83 0.14
84 0.08
85 0.07
86 0.1
87 0.12
88 0.16
89 0.17
90 0.18
91 0.18
92 0.18
93 0.24
94 0.22
95 0.25
96 0.24
97 0.24
98 0.22
99 0.24
100 0.25
101 0.24
102 0.25
103 0.21
104 0.21
105 0.23
106 0.24
107 0.22
108 0.2
109 0.17
110 0.16
111 0.15
112 0.14
113 0.12
114 0.14
115 0.17
116 0.18
117 0.17
118 0.16
119 0.16
120 0.14
121 0.15
122 0.12
123 0.12
124 0.13
125 0.12
126 0.12
127 0.12
128 0.11
129 0.12
130 0.12
131 0.11
132 0.1
133 0.1
134 0.1
135 0.12
136 0.14
137 0.13
138 0.12
139 0.12
140 0.13
141 0.15
142 0.17
143 0.16
144 0.14
145 0.14
146 0.16
147 0.19
148 0.18
149 0.19
150 0.17
151 0.17
152 0.18
153 0.22
154 0.24
155 0.23
156 0.25
157 0.26
158 0.27
159 0.27
160 0.26
161 0.22
162 0.18
163 0.17
164 0.16
165 0.12
166 0.13
167 0.13
168 0.13
169 0.16