Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q2D113

Protein Details
Accession A0A4Q2D113    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
33-57GEGDRKKKKLAKKEQAKKQQAREQEBasic
NLS Segment(s)
PositionSequence
37-50RKKKKLAKKEQAKK
Subcellular Location(s) cyto_nucl 17.333, nucl 15.5, cyto 11, mito_nucl 9.164
Family & Domain DBs
Amino Acid Sequences MSLSQPNYQRCHEVPTIHLDVLAEDLPGTGVAGEGDRKKKKLAKKEQAKKQQAREQEDRPPPCITQSHSPNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.38
4 0.32
5 0.31
6 0.24
7 0.2
8 0.19
9 0.17
10 0.09
11 0.06
12 0.06
13 0.05
14 0.05
15 0.05
16 0.03
17 0.03
18 0.03
19 0.03
20 0.06
21 0.09
22 0.16
23 0.18
24 0.19
25 0.24
26 0.29
27 0.37
28 0.46
29 0.54
30 0.58
31 0.67
32 0.76
33 0.83
34 0.88
35 0.91
36 0.88
37 0.86
38 0.82
39 0.79
40 0.77
41 0.74
42 0.68
43 0.68
44 0.7
45 0.64
46 0.6
47 0.55
48 0.47
49 0.44
50 0.43
51 0.39
52 0.4