Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q2DNJ4

Protein Details
Accession A0A4Q2DNJ4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
163-187ESPSGPSSSKKRRRLEDRVKPDVKMHydrophilic
NLS Segment(s)
PositionSequence
172-176KKRRR
Subcellular Location(s) nucl 13, cyto_nucl 10.666, mito_nucl 10.166, cyto_mito 7.166, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences MFNRALRYPSCSIEVLEAFRLMVKRNRESFPETNPQEDGTPLEAAAEKEEKDAKKRSVHLFDLPRRLFRNLENRPRWTDNDAPLPYLRHIFDTFKGDDDEPRPDANANQGYALTKAVHIRFIPLVRFLLDHGASPEPKDCLAIIVAIRQKNLPLVKMLIERQESPSGPSSSKKRRRLEDRVKPDVKMLKEAVRCKARDITEYLYHEKGVVPDMTTLQMMM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.26
3 0.24
4 0.21
5 0.18
6 0.19
7 0.2
8 0.19
9 0.23
10 0.28
11 0.35
12 0.4
13 0.43
14 0.46
15 0.53
16 0.53
17 0.54
18 0.58
19 0.52
20 0.49
21 0.47
22 0.43
23 0.35
24 0.31
25 0.26
26 0.18
27 0.16
28 0.13
29 0.13
30 0.13
31 0.13
32 0.15
33 0.14
34 0.12
35 0.14
36 0.2
37 0.21
38 0.26
39 0.33
40 0.35
41 0.4
42 0.46
43 0.52
44 0.53
45 0.55
46 0.57
47 0.6
48 0.61
49 0.64
50 0.59
51 0.56
52 0.52
53 0.5
54 0.44
55 0.41
56 0.45
57 0.44
58 0.54
59 0.55
60 0.57
61 0.61
62 0.63
63 0.6
64 0.54
65 0.51
66 0.44
67 0.47
68 0.43
69 0.38
70 0.35
71 0.34
72 0.29
73 0.25
74 0.22
75 0.15
76 0.17
77 0.17
78 0.18
79 0.21
80 0.2
81 0.19
82 0.2
83 0.18
84 0.19
85 0.19
86 0.2
87 0.17
88 0.17
89 0.16
90 0.15
91 0.15
92 0.17
93 0.17
94 0.14
95 0.13
96 0.13
97 0.13
98 0.13
99 0.14
100 0.08
101 0.07
102 0.1
103 0.1
104 0.12
105 0.12
106 0.13
107 0.14
108 0.15
109 0.15
110 0.13
111 0.13
112 0.12
113 0.12
114 0.11
115 0.13
116 0.11
117 0.11
118 0.12
119 0.13
120 0.13
121 0.14
122 0.14
123 0.11
124 0.11
125 0.12
126 0.1
127 0.08
128 0.08
129 0.09
130 0.08
131 0.12
132 0.16
133 0.16
134 0.17
135 0.16
136 0.17
137 0.2
138 0.21
139 0.17
140 0.15
141 0.16
142 0.18
143 0.22
144 0.23
145 0.23
146 0.24
147 0.24
148 0.27
149 0.29
150 0.27
151 0.27
152 0.3
153 0.28
154 0.27
155 0.31
156 0.37
157 0.44
158 0.54
159 0.6
160 0.63
161 0.7
162 0.79
163 0.85
164 0.87
165 0.87
166 0.86
167 0.87
168 0.82
169 0.73
170 0.69
171 0.65
172 0.56
173 0.5
174 0.44
175 0.41
176 0.45
177 0.5
178 0.52
179 0.53
180 0.51
181 0.5
182 0.54
183 0.49
184 0.46
185 0.46
186 0.44
187 0.44
188 0.48
189 0.49
190 0.42
191 0.4
192 0.36
193 0.33
194 0.27
195 0.23
196 0.19
197 0.16
198 0.16
199 0.18
200 0.19