Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q2DDA7

Protein Details
Accession A0A4Q2DDA7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-53DEEYERRSAEKKKKKNKKFEQSLKELRRRTBasic
NLS Segment(s)
PositionSequence
29-62RRSAEKKKKKNKKFEQSLKELRRRTKEGVWQRRK
Subcellular Location(s) nucl 17, cyto_nucl 14, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009061  DNA-bd_dom_put_sf  
IPR000465  XPA  
IPR037129  XPA_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003684  F:damaged DNA binding  
GO:0006289  P:nucleotide-excision repair  
Amino Acid Sequences MMLFLRYQVEEFAWKKWGSPEALDEEYERRSAEKKKKKNKKFEQSLKELRRRTKEGVWQRRKDEEHKHAFGPLERDQEGNSRQVCHTCGFVVEVEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.28
4 0.31
5 0.26
6 0.26
7 0.28
8 0.28
9 0.3
10 0.29
11 0.26
12 0.24
13 0.23
14 0.22
15 0.18
16 0.13
17 0.16
18 0.25
19 0.34
20 0.43
21 0.52
22 0.62
23 0.73
24 0.82
25 0.89
26 0.9
27 0.91
28 0.91
29 0.91
30 0.88
31 0.86
32 0.87
33 0.84
34 0.8
35 0.74
36 0.69
37 0.65
38 0.62
39 0.57
40 0.52
41 0.54
42 0.57
43 0.63
44 0.67
45 0.67
46 0.66
47 0.7
48 0.68
49 0.66
50 0.65
51 0.63
52 0.62
53 0.59
54 0.56
55 0.51
56 0.49
57 0.44
58 0.4
59 0.34
60 0.31
61 0.28
62 0.28
63 0.26
64 0.31
65 0.31
66 0.31
67 0.28
68 0.26
69 0.27
70 0.29
71 0.3
72 0.25
73 0.25
74 0.19
75 0.19
76 0.18
77 0.17