Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1Q3B8

Protein Details
Accession A0A4V1Q3B8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
220-258LRPSLVRSHRRQVRRQSPAPSKHLNPSRRLKSRQHLLVGHydrophilic
NLS Segment(s)
PositionSequence
229-242RRQVRRQSPAPSKH
247-247R
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR026983  DHC_fam  
IPR024743  Dynein_HC_stalk  
IPR015940  UBA  
IPR009060  UBA-like_sf  
Gene Ontology GO:0030286  C:dynein complex  
GO:0045505  F:dynein intermediate chain binding  
GO:0051959  F:dynein light intermediate chain binding  
GO:0008569  F:minus-end-directed microtubule motor activity  
GO:0007018  P:microtubule-based movement  
Pfam View protein in Pfam  
PF12777  MT  
PF00627  UBA  
PROSITE View protein in PROSITE  
PS50030  UBA  
Amino Acid Sequences MADLADGEPAVLEAQSAVSNIKRQHLQEARMVANLPEAVKLAIESICTILGHKIDSWRTVQGIIRRDDFIQRIVNFDTATHMTKPLREIIKKDFLSRPSYDFETVNRASKACGPLAKWVLAQVHFSEILDRVEPLRNEVRPLEDQAETTKKQGAAIIDMGFSRSAAERALVRTHNNVNAAAELLVNQPFPLPPDPQPEPTLLLPQKSPSPMRDPPKLLLLRPSLVRSHRRQVRRQSPAPSKHLNPSRRLKSRQHLLVGQQKNGAQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.08
5 0.1
6 0.16
7 0.18
8 0.24
9 0.28
10 0.29
11 0.39
12 0.44
13 0.46
14 0.46
15 0.5
16 0.45
17 0.42
18 0.41
19 0.31
20 0.26
21 0.24
22 0.19
23 0.14
24 0.13
25 0.11
26 0.1
27 0.1
28 0.09
29 0.08
30 0.08
31 0.08
32 0.08
33 0.09
34 0.09
35 0.09
36 0.1
37 0.1
38 0.11
39 0.12
40 0.16
41 0.18
42 0.2
43 0.22
44 0.22
45 0.22
46 0.23
47 0.26
48 0.26
49 0.31
50 0.32
51 0.32
52 0.31
53 0.31
54 0.33
55 0.31
56 0.29
57 0.29
58 0.26
59 0.26
60 0.26
61 0.26
62 0.22
63 0.2
64 0.2
65 0.17
66 0.19
67 0.16
68 0.18
69 0.18
70 0.19
71 0.21
72 0.24
73 0.28
74 0.28
75 0.31
76 0.34
77 0.44
78 0.43
79 0.46
80 0.44
81 0.41
82 0.44
83 0.41
84 0.37
85 0.31
86 0.33
87 0.3
88 0.26
89 0.24
90 0.25
91 0.25
92 0.26
93 0.23
94 0.2
95 0.2
96 0.23
97 0.24
98 0.19
99 0.19
100 0.17
101 0.22
102 0.24
103 0.24
104 0.2
105 0.2
106 0.2
107 0.18
108 0.18
109 0.13
110 0.12
111 0.11
112 0.11
113 0.1
114 0.09
115 0.09
116 0.08
117 0.08
118 0.08
119 0.11
120 0.11
121 0.13
122 0.16
123 0.16
124 0.18
125 0.18
126 0.2
127 0.18
128 0.2
129 0.19
130 0.16
131 0.16
132 0.18
133 0.22
134 0.19
135 0.19
136 0.2
137 0.17
138 0.17
139 0.19
140 0.16
141 0.13
142 0.14
143 0.14
144 0.11
145 0.11
146 0.11
147 0.09
148 0.09
149 0.07
150 0.06
151 0.06
152 0.06
153 0.07
154 0.08
155 0.1
156 0.14
157 0.15
158 0.16
159 0.2
160 0.22
161 0.24
162 0.24
163 0.23
164 0.19
165 0.18
166 0.17
167 0.13
168 0.1
169 0.08
170 0.08
171 0.08
172 0.07
173 0.07
174 0.07
175 0.07
176 0.1
177 0.12
178 0.13
179 0.16
180 0.24
181 0.27
182 0.3
183 0.32
184 0.3
185 0.31
186 0.29
187 0.34
188 0.29
189 0.27
190 0.25
191 0.25
192 0.28
193 0.29
194 0.31
195 0.26
196 0.32
197 0.39
198 0.44
199 0.5
200 0.51
201 0.48
202 0.55
203 0.54
204 0.47
205 0.46
206 0.43
207 0.39
208 0.37
209 0.38
210 0.35
211 0.39
212 0.46
213 0.46
214 0.52
215 0.58
216 0.64
217 0.7
218 0.76
219 0.8
220 0.81
221 0.82
222 0.82
223 0.83
224 0.83
225 0.82
226 0.78
227 0.71
228 0.71
229 0.74
230 0.7
231 0.69
232 0.71
233 0.74
234 0.76
235 0.79
236 0.79
237 0.8
238 0.83
239 0.82
240 0.79
241 0.74
242 0.73
243 0.75
244 0.71
245 0.64
246 0.58