Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q2D0C7

Protein Details
Accession A0A4Q2D0C7    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-70WRGSLPPEKKKKAPKLRCKPDPKDPRABasic
NLS Segment(s)
PositionSequence
49-64PPEKKKKAPKLRCKPD
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 2, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MGDAIICGYVLKHSAFQELIQGTPTMQEFVEIYGANPVQVYDRWRGSLPPEKKKKAPKLRCKPDPKDPRAAPDFLFISRYRLLHSQSQFQRLRINGYLKETEKDKSRLRDWLQFIRDDGGPVLQAEQFTFGQMVDEDPGMYNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.22
5 0.21
6 0.21
7 0.18
8 0.18
9 0.14
10 0.16
11 0.16
12 0.11
13 0.09
14 0.1
15 0.09
16 0.09
17 0.12
18 0.09
19 0.09
20 0.12
21 0.12
22 0.11
23 0.11
24 0.1
25 0.1
26 0.11
27 0.15
28 0.15
29 0.17
30 0.19
31 0.19
32 0.2
33 0.24
34 0.32
35 0.37
36 0.43
37 0.52
38 0.55
39 0.61
40 0.7
41 0.75
42 0.77
43 0.79
44 0.8
45 0.82
46 0.88
47 0.91
48 0.91
49 0.86
50 0.86
51 0.86
52 0.79
53 0.78
54 0.68
55 0.64
56 0.57
57 0.52
58 0.42
59 0.34
60 0.3
61 0.2
62 0.22
63 0.16
64 0.17
65 0.17
66 0.16
67 0.15
68 0.17
69 0.2
70 0.24
71 0.26
72 0.31
73 0.32
74 0.42
75 0.41
76 0.4
77 0.42
78 0.36
79 0.39
80 0.35
81 0.36
82 0.29
83 0.32
84 0.36
85 0.33
86 0.34
87 0.31
88 0.29
89 0.31
90 0.36
91 0.37
92 0.39
93 0.41
94 0.48
95 0.51
96 0.56
97 0.56
98 0.59
99 0.55
100 0.5
101 0.48
102 0.42
103 0.37
104 0.3
105 0.24
106 0.16
107 0.14
108 0.12
109 0.13
110 0.11
111 0.11
112 0.1
113 0.13
114 0.12
115 0.12
116 0.12
117 0.1
118 0.11
119 0.11
120 0.12
121 0.1
122 0.1
123 0.1