Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q2DPJ7

Protein Details
Accession A0A4Q2DPJ7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRNPRKVRWTKAFRKAAGKEBasic
NLS Segment(s)
PositionSequence
6-9RKVR
53-87KRIGEIRAKRERAFFKNRMAVSRAKHKEHRKKMLE
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MKRNPRKVRWTKAFRKAAGKEMTIDSTIDFEKRRNVPVRYNRELVQTTIKAMKRIGEIRAKRERAFFKNRMAVSRAKHKEHRKKMLEAAKSSSLKLRQPVEATVEPIREKIKVGVKSRSALVPGEGRSMGMDID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.76
4 0.74
5 0.69
6 0.59
7 0.52
8 0.45
9 0.42
10 0.33
11 0.3
12 0.21
13 0.17
14 0.17
15 0.16
16 0.14
17 0.14
18 0.21
19 0.23
20 0.3
21 0.35
22 0.39
23 0.46
24 0.55
25 0.63
26 0.61
27 0.61
28 0.55
29 0.53
30 0.51
31 0.43
32 0.39
33 0.3
34 0.27
35 0.3
36 0.3
37 0.26
38 0.25
39 0.25
40 0.23
41 0.25
42 0.28
43 0.3
44 0.31
45 0.38
46 0.46
47 0.47
48 0.44
49 0.47
50 0.49
51 0.47
52 0.53
53 0.5
54 0.47
55 0.5
56 0.5
57 0.46
58 0.42
59 0.4
60 0.34
61 0.41
62 0.4
63 0.39
64 0.46
65 0.55
66 0.63
67 0.69
68 0.76
69 0.71
70 0.7
71 0.73
72 0.73
73 0.68
74 0.6
75 0.55
76 0.52
77 0.47
78 0.44
79 0.4
80 0.36
81 0.33
82 0.36
83 0.34
84 0.3
85 0.31
86 0.32
87 0.34
88 0.31
89 0.32
90 0.29
91 0.29
92 0.26
93 0.26
94 0.26
95 0.19
96 0.2
97 0.22
98 0.28
99 0.33
100 0.38
101 0.44
102 0.47
103 0.48
104 0.49
105 0.46
106 0.39
107 0.33
108 0.3
109 0.28
110 0.25
111 0.26
112 0.24
113 0.22
114 0.21