Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q2D5V6

Protein Details
Accession A0A4Q2D5V6   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
35-58GMMPLEPVKRPKRRRSAEEDDESDAcidic
NLS Segment(s)
PositionSequence
43-48KRPKRR
Subcellular Location(s) nucl 15, extr 7, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MNSVFTSIKVLQTYEARWHSAGRFCDILMALVSMGMMPLEPVKRPKRRRSAEEDDESDIEDTDDQQFYSPGPQNDVNIEAATASPTNTSASIRTNDPPASESPRSLPTTNQSQENVATGASTDLPLDGFHFDTPDLAGSFSQMNGVESGQNMTWSQQLEQLQTLYGYGQHPAGPPSAGAGIPAPFGTIFSGPTGAPPTSTTSVYQWPNTQSPSSTGSGQGSDGLLTTQDAVLWTGVPSGYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.31
4 0.31
5 0.33
6 0.34
7 0.37
8 0.37
9 0.33
10 0.31
11 0.28
12 0.3
13 0.27
14 0.23
15 0.17
16 0.15
17 0.1
18 0.09
19 0.09
20 0.06
21 0.05
22 0.04
23 0.03
24 0.03
25 0.07
26 0.08
27 0.11
28 0.2
29 0.3
30 0.4
31 0.5
32 0.6
33 0.68
34 0.76
35 0.82
36 0.83
37 0.84
38 0.83
39 0.81
40 0.74
41 0.66
42 0.57
43 0.5
44 0.4
45 0.3
46 0.21
47 0.13
48 0.11
49 0.1
50 0.1
51 0.08
52 0.09
53 0.09
54 0.09
55 0.15
56 0.19
57 0.17
58 0.21
59 0.22
60 0.22
61 0.23
62 0.25
63 0.19
64 0.15
65 0.14
66 0.1
67 0.08
68 0.09
69 0.07
70 0.06
71 0.05
72 0.06
73 0.07
74 0.07
75 0.08
76 0.08
77 0.11
78 0.13
79 0.15
80 0.16
81 0.19
82 0.19
83 0.18
84 0.19
85 0.19
86 0.24
87 0.22
88 0.22
89 0.21
90 0.25
91 0.27
92 0.26
93 0.25
94 0.21
95 0.29
96 0.3
97 0.3
98 0.26
99 0.24
100 0.24
101 0.23
102 0.2
103 0.11
104 0.09
105 0.06
106 0.06
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.05
115 0.06
116 0.05
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.05
124 0.05
125 0.06
126 0.06
127 0.06
128 0.07
129 0.06
130 0.07
131 0.07
132 0.07
133 0.07
134 0.07
135 0.08
136 0.07
137 0.08
138 0.07
139 0.08
140 0.09
141 0.1
142 0.1
143 0.13
144 0.15
145 0.15
146 0.16
147 0.16
148 0.14
149 0.13
150 0.13
151 0.08
152 0.09
153 0.08
154 0.08
155 0.08
156 0.09
157 0.1
158 0.11
159 0.12
160 0.1
161 0.1
162 0.1
163 0.1
164 0.09
165 0.09
166 0.08
167 0.08
168 0.08
169 0.08
170 0.07
171 0.06
172 0.07
173 0.08
174 0.07
175 0.08
176 0.08
177 0.09
178 0.09
179 0.1
180 0.13
181 0.12
182 0.12
183 0.13
184 0.18
185 0.2
186 0.21
187 0.21
188 0.21
189 0.28
190 0.31
191 0.32
192 0.3
193 0.33
194 0.35
195 0.37
196 0.36
197 0.3
198 0.3
199 0.32
200 0.3
201 0.27
202 0.25
203 0.24
204 0.23
205 0.22
206 0.2
207 0.15
208 0.13
209 0.12
210 0.09
211 0.08
212 0.08
213 0.08
214 0.07
215 0.07
216 0.08
217 0.08
218 0.08
219 0.09
220 0.08
221 0.09