Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q7K7E6

Protein Details
Accession A0A4Q7K7E6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-80MIRSNRKKAAKAKAAAKKKNHydrophilic
NLS Segment(s)
PositionSequence
65-80NRKKAAKAKAAAKKKN
Subcellular Location(s) plas 18, E.R. 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLVAASVVFLYYTIWTLIMPFVDEHHTLQDFFLPREWAIRIPVILVLLGSAVVGSFLGLVMIRSNRKKAAKAKAAAKKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.07
6 0.08
7 0.07
8 0.08
9 0.11
10 0.12
11 0.13
12 0.15
13 0.15
14 0.14
15 0.14
16 0.17
17 0.15
18 0.14
19 0.15
20 0.14
21 0.13
22 0.15
23 0.15
24 0.12
25 0.12
26 0.12
27 0.1
28 0.09
29 0.1
30 0.08
31 0.07
32 0.06
33 0.04
34 0.03
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.03
46 0.03
47 0.05
48 0.09
49 0.16
50 0.19
51 0.23
52 0.3
53 0.35
54 0.43
55 0.49
56 0.57
57 0.6
58 0.65
59 0.72
60 0.75