Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q7K2S5

Protein Details
Accession A0A4Q7K2S5    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MKRNPRKLKWTKAYRKNAGKEMVHydrophilic
NLS Segment(s)
PositionSequence
61-77RRERVFYKKRMAGKRER
Subcellular Location(s) mito 15, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MKRNPRKLKWTKAYRKNAGKEMVVDSTLLFGARRNEPVRYDRDLVQKTLGAMQRISEIRARRERVFYKKRMAGKRERELATARELVAKNEHLLPRMRGSEKRRLEELAAEQGLDVEELAAEHLQNAKNDNKLFGGEKRRLKVRVDGGIEGEEDNDMDMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.88
4 0.85
5 0.78
6 0.7
7 0.62
8 0.55
9 0.47
10 0.37
11 0.3
12 0.22
13 0.18
14 0.16
15 0.13
16 0.09
17 0.09
18 0.13
19 0.15
20 0.21
21 0.22
22 0.25
23 0.29
24 0.34
25 0.37
26 0.38
27 0.39
28 0.38
29 0.45
30 0.45
31 0.42
32 0.39
33 0.34
34 0.29
35 0.32
36 0.29
37 0.21
38 0.18
39 0.17
40 0.2
41 0.2
42 0.21
43 0.19
44 0.2
45 0.26
46 0.33
47 0.37
48 0.35
49 0.41
50 0.46
51 0.53
52 0.59
53 0.57
54 0.58
55 0.59
56 0.65
57 0.66
58 0.66
59 0.65
60 0.66
61 0.67
62 0.67
63 0.62
64 0.55
65 0.5
66 0.45
67 0.38
68 0.3
69 0.23
70 0.21
71 0.2
72 0.19
73 0.19
74 0.18
75 0.15
76 0.18
77 0.19
78 0.16
79 0.18
80 0.18
81 0.2
82 0.23
83 0.25
84 0.28
85 0.33
86 0.41
87 0.45
88 0.47
89 0.45
90 0.43
91 0.41
92 0.38
93 0.35
94 0.31
95 0.25
96 0.22
97 0.2
98 0.18
99 0.17
100 0.13
101 0.1
102 0.03
103 0.03
104 0.03
105 0.04
106 0.04
107 0.04
108 0.05
109 0.09
110 0.11
111 0.12
112 0.16
113 0.18
114 0.24
115 0.25
116 0.26
117 0.23
118 0.24
119 0.26
120 0.3
121 0.36
122 0.38
123 0.45
124 0.49
125 0.55
126 0.56
127 0.56
128 0.57
129 0.57
130 0.57
131 0.54
132 0.5
133 0.45
134 0.43
135 0.4
136 0.31
137 0.24
138 0.15
139 0.11