Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q7K141

Protein Details
Accession A0A4Q7K141    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-51TSDEPLKRRLRPRREKAEAABasic
72-98GSSSGHKPRTRKKPNRVNKNTAAKARPHydrophilic
NLS Segment(s)
PositionSequence
38-46KRRLRPRRE
77-99HKPRTRKKPNRVNKNTAAKARPG
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MVAIKMPDEPAELDNVSMYGFGAIPNLEASLTSDEPLKRRLRPRREKAEAASQPDLVLVNVRQRTSNSAALGSSSGHKPRTRKKPNRVNKNTAAKARPGSKNLPIEILDSDKKAASSDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.09
5 0.08
6 0.05
7 0.05
8 0.05
9 0.06
10 0.05
11 0.06
12 0.06
13 0.06
14 0.05
15 0.05
16 0.08
17 0.11
18 0.11
19 0.11
20 0.15
21 0.16
22 0.18
23 0.25
24 0.27
25 0.29
26 0.39
27 0.49
28 0.56
29 0.66
30 0.74
31 0.79
32 0.81
33 0.8
34 0.74
35 0.74
36 0.67
37 0.62
38 0.53
39 0.42
40 0.35
41 0.3
42 0.27
43 0.16
44 0.13
45 0.07
46 0.11
47 0.12
48 0.13
49 0.13
50 0.14
51 0.18
52 0.22
53 0.24
54 0.2
55 0.18
56 0.18
57 0.18
58 0.18
59 0.14
60 0.12
61 0.11
62 0.14
63 0.17
64 0.2
65 0.27
66 0.36
67 0.47
68 0.57
69 0.64
70 0.73
71 0.8
72 0.87
73 0.92
74 0.92
75 0.89
76 0.88
77 0.88
78 0.84
79 0.81
80 0.73
81 0.66
82 0.63
83 0.63
84 0.59
85 0.53
86 0.52
87 0.52
88 0.55
89 0.51
90 0.48
91 0.41
92 0.37
93 0.34
94 0.34
95 0.29
96 0.24
97 0.24
98 0.22
99 0.21