Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q7JGY2

Protein Details
Accession A0A4Q7JGY2    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
14-36LILTHNPRRHHNRRLPHLHHPLPBasic
55-103QAQHTTRRNLPRPRRRRLQHHRPDPQRRIQHKQKQQHPRHGPQHNRNDYBasic
NLS Segment(s)
PositionSequence
61-108RRNLPRPRRRRLQHHRPDPQRRIQHKQKQQHPRHGPQHNRNDYPRRRR
Subcellular Location(s) nucl 13, mito 11, plas 2
Family & Domain DBs
Amino Acid Sequences MPPTPPMLLHHNNLILTHNPRRHHNRRLPHLHHPLPLHLHRPRPPMPPTMPPTPQAQHTTRRNLPRPRRRRLQHHRPDPQRRIQHKQKQQHPRHGPQHNRNDYPRRRRGIQVIVRRWDDDECGRRGGLSRDDYRGICKCGVEMIRFTRIAGARWEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.31
4 0.38
5 0.39
6 0.39
7 0.48
8 0.58
9 0.63
10 0.69
11 0.71
12 0.73
13 0.78
14 0.85
15 0.83
16 0.83
17 0.85
18 0.78
19 0.74
20 0.66
21 0.59
22 0.56
23 0.52
24 0.5
25 0.44
26 0.47
27 0.47
28 0.53
29 0.53
30 0.53
31 0.53
32 0.52
33 0.52
34 0.53
35 0.52
36 0.52
37 0.5
38 0.44
39 0.46
40 0.4
41 0.4
42 0.37
43 0.35
44 0.37
45 0.41
46 0.48
47 0.49
48 0.56
49 0.6
50 0.65
51 0.72
52 0.74
53 0.78
54 0.79
55 0.82
56 0.81
57 0.84
58 0.84
59 0.85
60 0.85
61 0.86
62 0.87
63 0.87
64 0.9
65 0.84
66 0.82
67 0.8
68 0.76
69 0.75
70 0.76
71 0.75
72 0.74
73 0.78
74 0.79
75 0.8
76 0.82
77 0.83
78 0.82
79 0.81
80 0.81
81 0.81
82 0.82
83 0.8
84 0.83
85 0.8
86 0.76
87 0.74
88 0.75
89 0.75
90 0.76
91 0.75
92 0.69
93 0.65
94 0.65
95 0.66
96 0.66
97 0.65
98 0.65
99 0.64
100 0.64
101 0.62
102 0.58
103 0.53
104 0.43
105 0.38
106 0.35
107 0.33
108 0.29
109 0.29
110 0.28
111 0.27
112 0.29
113 0.3
114 0.29
115 0.3
116 0.31
117 0.33
118 0.37
119 0.37
120 0.41
121 0.41
122 0.37
123 0.32
124 0.29
125 0.25
126 0.28
127 0.32
128 0.28
129 0.3
130 0.31
131 0.35
132 0.35
133 0.35
134 0.35
135 0.33
136 0.32