Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q7JPU2

Protein Details
Accession A0A4Q7JPU2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-23ADISIKKRKRDGESSGKPKKKVBasic
NLS Segment(s)
PositionSequence
7-22KKRKRDGESSGKPKKK
Subcellular Location(s) nucl 10, cyto 8, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR009668  RNA_pol-assoc_fac_A49-like  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0005730  C:nucleolus  
GO:0003677  F:DNA binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF06870  RNA_pol_I_A49  
Amino Acid Sequences MADISIKKRKRDGESSGKPKKKVVLDAPADKAAVSNVLRSRHCPPVIATTPGIEVPENIAFRSYQPQEGSRPKSSKSKQGGDKELLLHSTSHQSLDYTAREESYRGTNQLVNHFVGIYDPKTGKLEAVEAKKMTVRVTVRARQAPASSMGENQAKQSMLERRTDLGQTFGTKKAKKVIRETVLNAIAPQRKPGDSPTKMDDAARAVLKSVGQITTNMATKEELQAAVDEAKPVPKANMDASDIHDVYDPKVIIGADVLNLVPIREWQEKVRHEEGIQTASRFVAARVNAIASNDDAVTRLRVLRYFNFVLMFYLSSKPGRQRGTRQILPRDKLRDVLSPAPEAVVESIRRKFSDAGVMRKFHIDLLMAYCCVFACIVDNFEVDTQNLRDDLRVDQKTLNQYFYEIGGRVKPVSSKAQGSPAVHMGRLVLPLVFPKQRQIAPRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.86
4 0.85
5 0.78
6 0.74
7 0.72
8 0.68
9 0.66
10 0.64
11 0.64
12 0.65
13 0.69
14 0.69
15 0.63
16 0.56
17 0.46
18 0.37
19 0.27
20 0.25
21 0.18
22 0.2
23 0.23
24 0.29
25 0.31
26 0.35
27 0.39
28 0.43
29 0.43
30 0.4
31 0.38
32 0.42
33 0.45
34 0.45
35 0.4
36 0.32
37 0.32
38 0.3
39 0.29
40 0.18
41 0.15
42 0.14
43 0.19
44 0.18
45 0.16
46 0.17
47 0.16
48 0.18
49 0.26
50 0.24
51 0.24
52 0.27
53 0.3
54 0.38
55 0.47
56 0.52
57 0.53
58 0.54
59 0.53
60 0.61
61 0.62
62 0.64
63 0.63
64 0.65
65 0.66
66 0.71
67 0.75
68 0.68
69 0.68
70 0.6
71 0.53
72 0.45
73 0.36
74 0.28
75 0.22
76 0.23
77 0.2
78 0.18
79 0.17
80 0.16
81 0.17
82 0.21
83 0.21
84 0.18
85 0.17
86 0.18
87 0.18
88 0.18
89 0.18
90 0.2
91 0.21
92 0.21
93 0.22
94 0.24
95 0.26
96 0.32
97 0.32
98 0.26
99 0.24
100 0.22
101 0.19
102 0.18
103 0.18
104 0.13
105 0.14
106 0.14
107 0.15
108 0.16
109 0.17
110 0.16
111 0.14
112 0.19
113 0.21
114 0.25
115 0.27
116 0.26
117 0.26
118 0.28
119 0.28
120 0.24
121 0.24
122 0.21
123 0.25
124 0.32
125 0.37
126 0.41
127 0.45
128 0.45
129 0.42
130 0.41
131 0.35
132 0.32
133 0.29
134 0.23
135 0.2
136 0.23
137 0.23
138 0.23
139 0.22
140 0.2
141 0.17
142 0.16
143 0.2
144 0.24
145 0.23
146 0.26
147 0.26
148 0.25
149 0.27
150 0.29
151 0.24
152 0.19
153 0.18
154 0.18
155 0.19
156 0.24
157 0.29
158 0.28
159 0.3
160 0.36
161 0.39
162 0.42
163 0.47
164 0.51
165 0.5
166 0.52
167 0.53
168 0.5
169 0.47
170 0.41
171 0.34
172 0.3
173 0.29
174 0.25
175 0.25
176 0.21
177 0.2
178 0.21
179 0.27
180 0.31
181 0.29
182 0.32
183 0.33
184 0.34
185 0.34
186 0.33
187 0.28
188 0.2
189 0.19
190 0.17
191 0.13
192 0.11
193 0.11
194 0.11
195 0.1
196 0.1
197 0.08
198 0.07
199 0.08
200 0.09
201 0.1
202 0.12
203 0.11
204 0.11
205 0.11
206 0.11
207 0.12
208 0.11
209 0.09
210 0.08
211 0.08
212 0.08
213 0.09
214 0.08
215 0.07
216 0.07
217 0.08
218 0.08
219 0.08
220 0.08
221 0.08
222 0.09
223 0.1
224 0.13
225 0.13
226 0.14
227 0.17
228 0.2
229 0.19
230 0.18
231 0.19
232 0.16
233 0.15
234 0.17
235 0.14
236 0.1
237 0.11
238 0.11
239 0.09
240 0.09
241 0.08
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.05
248 0.04
249 0.05
250 0.1
251 0.13
252 0.14
253 0.18
254 0.26
255 0.29
256 0.36
257 0.38
258 0.34
259 0.32
260 0.35
261 0.33
262 0.3
263 0.27
264 0.2
265 0.18
266 0.17
267 0.17
268 0.13
269 0.11
270 0.11
271 0.11
272 0.11
273 0.12
274 0.13
275 0.12
276 0.13
277 0.13
278 0.09
279 0.09
280 0.08
281 0.08
282 0.07
283 0.07
284 0.08
285 0.08
286 0.1
287 0.1
288 0.12
289 0.16
290 0.18
291 0.24
292 0.24
293 0.24
294 0.24
295 0.23
296 0.22
297 0.19
298 0.17
299 0.12
300 0.13
301 0.13
302 0.14
303 0.16
304 0.21
305 0.27
306 0.32
307 0.36
308 0.43
309 0.52
310 0.6
311 0.64
312 0.66
313 0.7
314 0.73
315 0.71
316 0.69
317 0.65
318 0.57
319 0.55
320 0.5
321 0.45
322 0.42
323 0.44
324 0.39
325 0.35
326 0.33
327 0.29
328 0.26
329 0.21
330 0.17
331 0.14
332 0.14
333 0.17
334 0.22
335 0.24
336 0.24
337 0.26
338 0.27
339 0.25
340 0.33
341 0.34
342 0.39
343 0.43
344 0.44
345 0.42
346 0.43
347 0.41
348 0.31
349 0.27
350 0.19
351 0.15
352 0.17
353 0.18
354 0.16
355 0.16
356 0.15
357 0.13
358 0.13
359 0.11
360 0.06
361 0.08
362 0.09
363 0.11
364 0.12
365 0.12
366 0.13
367 0.14
368 0.15
369 0.12
370 0.15
371 0.14
372 0.14
373 0.15
374 0.14
375 0.14
376 0.15
377 0.2
378 0.27
379 0.28
380 0.29
381 0.32
382 0.37
383 0.46
384 0.47
385 0.44
386 0.34
387 0.34
388 0.32
389 0.31
390 0.29
391 0.2
392 0.2
393 0.2
394 0.21
395 0.21
396 0.22
397 0.22
398 0.23
399 0.3
400 0.33
401 0.35
402 0.36
403 0.43
404 0.48
405 0.47
406 0.46
407 0.46
408 0.43
409 0.37
410 0.35
411 0.29
412 0.25
413 0.24
414 0.21
415 0.13
416 0.12
417 0.16
418 0.22
419 0.25
420 0.24
421 0.29
422 0.35
423 0.4
424 0.49