Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q7JZG6

Protein Details
Accession A0A4Q7JZG6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-124VAVKKAKGKGKKKGKGKGKKKGKGKGKGKGKGKGKGKGKGKGKGKGKKKAAKVVVBasic
NLS Segment(s)
PositionSequence
73-121KKAKGKGKKKGKGKGKKKGKGKGKGKGKGKGKGKGKGKGKGKGKKKAAK
Subcellular Location(s) extr 10, cyto 9, mito 5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MKLTFATVLLPYLLHSALAAPANTERGLDTDEQDVEERGFDIRDAHPLGVRGAGVGNAANNANNAAGTQVAVKKAKGKGKKKGKGKGKKKGKGKGKGKGKGKGKGKGKGKGKGKGKKKAAKVVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.1
5 0.12
6 0.11
7 0.1
8 0.11
9 0.13
10 0.13
11 0.13
12 0.11
13 0.1
14 0.12
15 0.12
16 0.13
17 0.13
18 0.13
19 0.14
20 0.14
21 0.14
22 0.12
23 0.11
24 0.1
25 0.08
26 0.07
27 0.07
28 0.09
29 0.08
30 0.13
31 0.14
32 0.14
33 0.14
34 0.15
35 0.15
36 0.13
37 0.12
38 0.08
39 0.07
40 0.06
41 0.05
42 0.05
43 0.04
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.03
54 0.04
55 0.05
56 0.06
57 0.09
58 0.1
59 0.11
60 0.16
61 0.22
62 0.29
63 0.37
64 0.44
65 0.52
66 0.62
67 0.71
68 0.75
69 0.79
70 0.83
71 0.84
72 0.86
73 0.87
74 0.87
75 0.87
76 0.87
77 0.87
78 0.87
79 0.87
80 0.85
81 0.85
82 0.84
83 0.84
84 0.83
85 0.83
86 0.81
87 0.79
88 0.78
89 0.77
90 0.75
91 0.75
92 0.75
93 0.75
94 0.75
95 0.75
96 0.75
97 0.75
98 0.77
99 0.77
100 0.79
101 0.81
102 0.83
103 0.83
104 0.84