Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q7JKV0

Protein Details
Accession A0A4Q7JKV0    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-49KKHVPIVKKRTARFNRHQSDRFKCLAASWRKPKGIDNRVRRRFRGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 12.833, nucl 7, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTARFNRHQSDRFKCLAASWRKPKGIDNRVRRRFRGTMTMPSIGFRTNKKTRYMMPSGHKSFLVNNVKDVELLMMHNRSYAAEIASAVSSRKRIDIIARAKQLGVKVTNAKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.79
3 0.79
4 0.79
5 0.81
6 0.81
7 0.82
8 0.85
9 0.83
10 0.81
11 0.77
12 0.69
13 0.59
14 0.49
15 0.43
16 0.45
17 0.45
18 0.47
19 0.5
20 0.55
21 0.56
22 0.57
23 0.61
24 0.62
25 0.63
26 0.63
27 0.65
28 0.69
29 0.76
30 0.81
31 0.75
32 0.72
33 0.65
34 0.59
35 0.58
36 0.5
37 0.49
38 0.48
39 0.48
40 0.41
41 0.37
42 0.35
43 0.27
44 0.25
45 0.18
46 0.22
47 0.26
48 0.3
49 0.33
50 0.35
51 0.37
52 0.42
53 0.45
54 0.43
55 0.43
56 0.48
57 0.48
58 0.46
59 0.42
60 0.35
61 0.32
62 0.35
63 0.37
64 0.28
65 0.26
66 0.27
67 0.27
68 0.26
69 0.25
70 0.16
71 0.08
72 0.09
73 0.1
74 0.09
75 0.09
76 0.1
77 0.1
78 0.09
79 0.1
80 0.1
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.08
88 0.09
89 0.11
90 0.12
91 0.13
92 0.13
93 0.14
94 0.2
95 0.29
96 0.36
97 0.42
98 0.46
99 0.45
100 0.45
101 0.45
102 0.42
103 0.38
104 0.32
105 0.28
106 0.31
107 0.36
108 0.42
109 0.41
110 0.4
111 0.37