Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2EQC0

Protein Details
Accession A0A4V2EQC0    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
156-186HEMRYKPPRLLGRRDPRHSRHKRRLVLDYDLBasic
NLS Segment(s)
PositionSequence
139-179PPRRDVVRRRPHLPIRGHEMRYKPPRLLGRRDPRHSRHKRR
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 5
Family & Domain DBs
Amino Acid Sequences MPFTGVTVSDHVAPIPFGITTAPSAVIYTSISYTTRRGDNLIQPPHHPSLLHRNLPPIPATSNLISPRHARPNHPIPRNAINNRKPPRPQLHPPIPPTHHHNRPPNPHHPHQMQQPPPRRRLPIIIAVLDLRAPLTPHPPRRDVVRRRPHLPIRGHEMRYKPPRLLGRRDPRHSRHKRRLVLDYDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.08
4 0.07
5 0.07
6 0.08
7 0.08
8 0.09
9 0.1
10 0.09
11 0.09
12 0.09
13 0.09
14 0.09
15 0.09
16 0.09
17 0.09
18 0.1
19 0.12
20 0.14
21 0.17
22 0.19
23 0.19
24 0.21
25 0.25
26 0.32
27 0.4
28 0.45
29 0.43
30 0.43
31 0.47
32 0.47
33 0.43
34 0.34
35 0.29
36 0.32
37 0.39
38 0.42
39 0.37
40 0.39
41 0.4
42 0.41
43 0.39
44 0.29
45 0.22
46 0.2
47 0.22
48 0.17
49 0.2
50 0.22
51 0.22
52 0.22
53 0.24
54 0.28
55 0.34
56 0.35
57 0.34
58 0.38
59 0.48
60 0.55
61 0.57
62 0.54
63 0.5
64 0.56
65 0.61
66 0.59
67 0.58
68 0.56
69 0.61
70 0.63
71 0.65
72 0.6
73 0.59
74 0.6
75 0.58
76 0.58
77 0.58
78 0.63
79 0.63
80 0.63
81 0.62
82 0.57
83 0.52
84 0.51
85 0.5
86 0.48
87 0.5
88 0.56
89 0.57
90 0.64
91 0.69
92 0.72
93 0.71
94 0.68
95 0.68
96 0.63
97 0.6
98 0.58
99 0.6
100 0.59
101 0.6
102 0.66
103 0.65
104 0.68
105 0.68
106 0.63
107 0.56
108 0.54
109 0.49
110 0.47
111 0.44
112 0.38
113 0.34
114 0.31
115 0.28
116 0.22
117 0.17
118 0.09
119 0.06
120 0.06
121 0.07
122 0.15
123 0.23
124 0.31
125 0.37
126 0.39
127 0.4
128 0.49
129 0.59
130 0.61
131 0.64
132 0.67
133 0.68
134 0.7
135 0.78
136 0.77
137 0.75
138 0.72
139 0.66
140 0.65
141 0.67
142 0.65
143 0.62
144 0.59
145 0.6
146 0.62
147 0.61
148 0.53
149 0.52
150 0.59
151 0.6
152 0.65
153 0.66
154 0.68
155 0.74
156 0.81
157 0.83
158 0.82
159 0.86
160 0.88
161 0.88
162 0.88
163 0.88
164 0.88
165 0.86
166 0.87