Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2EQE6

Protein Details
Accession A0A4V2EQE6   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-73YIHYATMKPEQKKKKRPADNSKGPAGRKHydrophilic
NLS Segment(s)
PositionSequence
55-73EQKKKKRPADNSKGPAGRK
Subcellular Location(s) cyto 9.5, cyto_nucl 6.5, mito 6, extr 3, E.R. 3, nucl 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MANFDWFKKIGATDEAVAVLNDQPYLFADLLAVLVALGLQCLLIWYIHYATMKPEQKKKKRPADNSKGPAGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.15
5 0.13
6 0.11
7 0.08
8 0.08
9 0.07
10 0.06
11 0.07
12 0.1
13 0.09
14 0.07
15 0.07
16 0.07
17 0.07
18 0.07
19 0.05
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.03
31 0.03
32 0.05
33 0.05
34 0.08
35 0.08
36 0.09
37 0.11
38 0.21
39 0.27
40 0.32
41 0.41
42 0.5
43 0.61
44 0.71
45 0.79
46 0.81
47 0.84
48 0.9
49 0.92
50 0.92
51 0.92
52 0.88
53 0.87