Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q7KBF7

Protein Details
Accession A0A4Q7KBF7   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
146-179LSRGSKNRKGNLCPNRKKRPPKSATKVEKREWYVHydrophilic
NLS Segment(s)
PositionSequence
159-171PNRKKRPPKSATK
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MASPHTYTCQELITAIKDGPSTYGYPWHRTLVYRQESKLIEQSSKVSHWLLSSLSNLCQRVTPDQGRHVENFKKLAEDEETKQKAAQDASSDLLWLNNAIIACRALEYLSGCMDTEDIKEVWRNERYRPTELEILQGFYDYAWICLSRGSKNRKGNLCPNRKKRPPKSATKVEKREWYVSESRSALGMIQARWEAGETLKQIIRNWLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.16
4 0.15
5 0.15
6 0.16
7 0.16
8 0.15
9 0.14
10 0.23
11 0.25
12 0.3
13 0.32
14 0.34
15 0.33
16 0.34
17 0.39
18 0.41
19 0.46
20 0.46
21 0.44
22 0.48
23 0.47
24 0.48
25 0.48
26 0.4
27 0.33
28 0.29
29 0.32
30 0.28
31 0.28
32 0.27
33 0.21
34 0.19
35 0.17
36 0.17
37 0.15
38 0.13
39 0.15
40 0.14
41 0.17
42 0.2
43 0.2
44 0.19
45 0.2
46 0.21
47 0.22
48 0.28
49 0.3
50 0.3
51 0.36
52 0.4
53 0.4
54 0.4
55 0.42
56 0.4
57 0.37
58 0.37
59 0.31
60 0.28
61 0.26
62 0.26
63 0.24
64 0.23
65 0.23
66 0.3
67 0.31
68 0.3
69 0.3
70 0.29
71 0.26
72 0.24
73 0.22
74 0.14
75 0.14
76 0.15
77 0.14
78 0.13
79 0.11
80 0.1
81 0.08
82 0.06
83 0.05
84 0.04
85 0.04
86 0.04
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.04
93 0.05
94 0.05
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.07
105 0.07
106 0.1
107 0.11
108 0.16
109 0.22
110 0.24
111 0.26
112 0.35
113 0.4
114 0.41
115 0.42
116 0.42
117 0.41
118 0.39
119 0.4
120 0.31
121 0.28
122 0.24
123 0.21
124 0.17
125 0.11
126 0.12
127 0.07
128 0.07
129 0.07
130 0.07
131 0.07
132 0.1
133 0.12
134 0.16
135 0.24
136 0.32
137 0.4
138 0.48
139 0.56
140 0.6
141 0.65
142 0.7
143 0.73
144 0.76
145 0.78
146 0.8
147 0.83
148 0.86
149 0.91
150 0.9
151 0.91
152 0.89
153 0.89
154 0.89
155 0.89
156 0.9
157 0.9
158 0.88
159 0.84
160 0.84
161 0.78
162 0.73
163 0.64
164 0.6
165 0.56
166 0.49
167 0.48
168 0.4
169 0.35
170 0.3
171 0.28
172 0.22
173 0.2
174 0.21
175 0.16
176 0.18
177 0.18
178 0.17
179 0.17
180 0.18
181 0.14
182 0.12
183 0.17
184 0.15
185 0.2
186 0.23
187 0.25
188 0.25