Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2EQQ6

Protein Details
Accession A0A4V2EQQ6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
93-117DWSDLPAKFKGRRRRKKQPEEKGGEBasic
NLS Segment(s)
PositionSequence
100-116KFKGRRRRKKQPEEKGG
Subcellular Location(s) extr 12, mito 7, plas 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MKISLVLASLTVLGSAVAQTTAAAAPTGEAMGQCSRSFGPKYPWGSCRLPGNKRVPCSKSSRCPIGPFGKWTCKLPEGKTEAECKPAHFRRTDWSDLPAKFKGRRRRKKQPEEKGGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.04
17 0.06
18 0.08
19 0.1
20 0.1
21 0.11
22 0.12
23 0.15
24 0.18
25 0.18
26 0.23
27 0.28
28 0.34
29 0.36
30 0.38
31 0.41
32 0.41
33 0.4
34 0.43
35 0.44
36 0.43
37 0.47
38 0.53
39 0.51
40 0.53
41 0.57
42 0.5
43 0.46
44 0.51
45 0.49
46 0.48
47 0.49
48 0.52
49 0.47
50 0.46
51 0.49
52 0.47
53 0.43
54 0.4
55 0.4
56 0.41
57 0.4
58 0.4
59 0.37
60 0.35
61 0.38
62 0.35
63 0.38
64 0.36
65 0.37
66 0.38
67 0.4
68 0.36
69 0.38
70 0.36
71 0.31
72 0.37
73 0.4
74 0.42
75 0.39
76 0.39
77 0.42
78 0.49
79 0.52
80 0.44
81 0.43
82 0.45
83 0.45
84 0.49
85 0.44
86 0.44
87 0.46
88 0.53
89 0.58
90 0.62
91 0.71
92 0.76
93 0.83
94 0.88
95 0.93
96 0.95
97 0.95