Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q7K731

Protein Details
Accession A0A4Q7K731    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
99-124EDKARVLEKTKKRNTHFPQRKFAIKAHydrophilic
NLS Segment(s)
PositionSequence
85-119RAKQTRAIRRRLSPEDKARVLEKTKKRNTHFPQRK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSGKVKTVQLWDKSKDDLMKQLGELKTELGQLRIQKVASSGSKLNKIHDLRKSIARVLTVINAKQRSQLRLFYKNKKYAPLDLRAKQTRAIRRRLSPEDKARVLEKTKKRNTHFPQRKFAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.52
3 0.47
4 0.42
5 0.4
6 0.37
7 0.34
8 0.32
9 0.37
10 0.33
11 0.3
12 0.28
13 0.22
14 0.2
15 0.22
16 0.21
17 0.15
18 0.18
19 0.19
20 0.21
21 0.21
22 0.2
23 0.17
24 0.17
25 0.2
26 0.19
27 0.2
28 0.21
29 0.23
30 0.3
31 0.3
32 0.31
33 0.35
34 0.37
35 0.4
36 0.41
37 0.42
38 0.37
39 0.42
40 0.42
41 0.36
42 0.34
43 0.28
44 0.24
45 0.2
46 0.21
47 0.17
48 0.17
49 0.19
50 0.19
51 0.19
52 0.24
53 0.25
54 0.25
55 0.26
56 0.32
57 0.33
58 0.42
59 0.49
60 0.53
61 0.6
62 0.64
63 0.63
64 0.63
65 0.6
66 0.58
67 0.57
68 0.56
69 0.56
70 0.52
71 0.59
72 0.57
73 0.55
74 0.52
75 0.54
76 0.54
77 0.53
78 0.58
79 0.56
80 0.58
81 0.66
82 0.7
83 0.7
84 0.7
85 0.72
86 0.71
87 0.67
88 0.63
89 0.56
90 0.53
91 0.52
92 0.53
93 0.53
94 0.56
95 0.63
96 0.7
97 0.74
98 0.79
99 0.82
100 0.83
101 0.85
102 0.82
103 0.83
104 0.8