Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q7JZM7

Protein Details
Accession A0A4Q7JZM7    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
20-40ASSARIKKNKKSNNVKFKVRCHydrophilic
NLS Segment(s)
PositionSequence
24-30RIKKNKK
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREVADIKKFIEICRRKDASSARIKKNKKSNNVKFKVRCQTHLYTLVLKDTDKAEKLKQSLPPMELNEDQDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.48
3 0.5
4 0.45
5 0.5
6 0.54
7 0.53
8 0.57
9 0.6
10 0.6
11 0.66
12 0.7
13 0.72
14 0.76
15 0.75
16 0.74
17 0.77
18 0.77
19 0.79
20 0.82
21 0.84
22 0.78
23 0.78
24 0.77
25 0.68
26 0.62
27 0.57
28 0.53
29 0.48
30 0.49
31 0.42
32 0.35
33 0.33
34 0.31
35 0.25
36 0.22
37 0.18
38 0.16
39 0.18
40 0.18
41 0.2
42 0.22
43 0.28
44 0.31
45 0.35
46 0.39
47 0.43
48 0.45
49 0.45
50 0.46
51 0.44
52 0.46
53 0.43
54 0.41