Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q7JRK5

Protein Details
Accession A0A4Q7JRK5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-39GGALKLKGAKVQKKKKKRDKADLEKNISTHydrophilic
NLS Segment(s)
PositionSequence
15-30KLKGAKVQKKKKKRDK
Subcellular Location(s) nucl 20, mito_nucl 13.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSGDYTAVGGGALKLKGAKVQKKKKKRDKADLEKNISTGQGSVTKTDSPPTTAKPTDDAEEQNSHSDNDTPVAMKTESERKYDEIRKKRLQKMAESSSSRPELLKTHKERVEELNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.16
5 0.25
6 0.33
7 0.41
8 0.52
9 0.62
10 0.73
11 0.84
12 0.89
13 0.92
14 0.93
15 0.93
16 0.94
17 0.94
18 0.95
19 0.93
20 0.9
21 0.8
22 0.7
23 0.59
24 0.48
25 0.37
26 0.26
27 0.17
28 0.15
29 0.15
30 0.15
31 0.16
32 0.17
33 0.17
34 0.2
35 0.18
36 0.17
37 0.18
38 0.21
39 0.25
40 0.25
41 0.25
42 0.25
43 0.26
44 0.25
45 0.24
46 0.22
47 0.19
48 0.2
49 0.2
50 0.18
51 0.17
52 0.15
53 0.14
54 0.13
55 0.1
56 0.09
57 0.09
58 0.08
59 0.07
60 0.09
61 0.09
62 0.08
63 0.1
64 0.18
65 0.2
66 0.22
67 0.23
68 0.24
69 0.31
70 0.4
71 0.47
72 0.48
73 0.55
74 0.62
75 0.7
76 0.76
77 0.75
78 0.71
79 0.7
80 0.69
81 0.67
82 0.66
83 0.61
84 0.55
85 0.54
86 0.51
87 0.43
88 0.35
89 0.29
90 0.28
91 0.31
92 0.4
93 0.4
94 0.47
95 0.5
96 0.52
97 0.53
98 0.54
99 0.54
100 0.46
101 0.42
102 0.41
103 0.38
104 0.37
105 0.35
106 0.28
107 0.21
108 0.19
109 0.2
110 0.19
111 0.21
112 0.27
113 0.33
114 0.34