Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q7JWR9

Protein Details
Accession A0A4Q7JWR9    Localization Confidence High Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
162-186AAQASRSPQRKPFRRPRRNSDSSVMHydrophilic
202-221EEHRMRDRQRREKALRDKAABasic
528-551LGRMKSLKGGRRPKNTETNPQPAAHydrophilic
NLS Segment(s)
PositionSequence
145-179EALRAKKPGPVPGPRPEAAQASRSPQRKPFRRPRR
206-262MRDRQRREKALRDKAARDKEGREKEDREGREGREPRDKEREGKGRSKSGRPSRPSRR
Subcellular Location(s) nucl 16, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MSSPGSFQQGQLPSPGLSINLSSNNPFRNRAASPASLEAAFASPTSTSPFDDPTPRQRPISRNPFLDQSQQPLKSPSALSSKSEHKSLSAEEIFDSLTLDDHMANDKLPPALTAQRRPSDQPIVPRTGTPQQPSNKHRPTKSQEEALRAKKPGPVPGPRPEAAQASRSPQRKPFRRPRRNSDSSVMDFNAQPITAEEMKIIEEHRMRDRQRREKALRDKAARDKEGREKEDREGREGREPRDKEREGKGRSKSGRPSRPSRRMDIIDQLDATSIYGTGLFHHDGPFDALNPHRNRQSSRRAPMQAFPKDSLNNSLGGMGPLNRNPDHATFLGHGTDEAFRDYSSGGKNKNGYNYPNSSSAEPAIFDPIARGTLVHGDESYGLGTSTFLEGTPAARSAIARRQAEQQQEFAEGGLQRKKSLAQRIRHINRGPRDMPSGRLTNPDAISSKRSPESVPLASSVGSEPNPFFAEFSKGEESISVKPRNGAKSPNSPTAIPRRLSGSALERRATTDATTPVEDAAPTKPSGILGRMKSLKGGRRPKNTETNPQPAAPGMAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.17
4 0.14
5 0.15
6 0.16
7 0.19
8 0.2
9 0.23
10 0.28
11 0.34
12 0.36
13 0.38
14 0.37
15 0.38
16 0.38
17 0.41
18 0.42
19 0.39
20 0.4
21 0.39
22 0.39
23 0.32
24 0.31
25 0.25
26 0.2
27 0.17
28 0.12
29 0.1
30 0.08
31 0.09
32 0.13
33 0.14
34 0.15
35 0.16
36 0.2
37 0.23
38 0.3
39 0.35
40 0.41
41 0.47
42 0.49
43 0.52
44 0.56
45 0.61
46 0.64
47 0.69
48 0.66
49 0.64
50 0.64
51 0.64
52 0.6
53 0.61
54 0.52
55 0.49
56 0.5
57 0.47
58 0.45
59 0.43
60 0.41
61 0.36
62 0.35
63 0.32
64 0.32
65 0.33
66 0.34
67 0.35
68 0.42
69 0.41
70 0.43
71 0.38
72 0.31
73 0.32
74 0.31
75 0.34
76 0.27
77 0.25
78 0.23
79 0.23
80 0.21
81 0.18
82 0.17
83 0.09
84 0.08
85 0.07
86 0.08
87 0.07
88 0.08
89 0.11
90 0.1
91 0.1
92 0.11
93 0.12
94 0.12
95 0.12
96 0.12
97 0.13
98 0.2
99 0.27
100 0.34
101 0.4
102 0.43
103 0.46
104 0.5
105 0.52
106 0.53
107 0.5
108 0.51
109 0.5
110 0.51
111 0.49
112 0.45
113 0.44
114 0.43
115 0.45
116 0.39
117 0.41
118 0.43
119 0.52
120 0.58
121 0.64
122 0.66
123 0.68
124 0.68
125 0.71
126 0.71
127 0.72
128 0.71
129 0.69
130 0.64
131 0.64
132 0.68
133 0.64
134 0.62
135 0.53
136 0.49
137 0.45
138 0.44
139 0.44
140 0.42
141 0.44
142 0.45
143 0.52
144 0.57
145 0.52
146 0.52
147 0.46
148 0.44
149 0.37
150 0.35
151 0.28
152 0.28
153 0.35
154 0.36
155 0.37
156 0.41
157 0.49
158 0.55
159 0.64
160 0.69
161 0.74
162 0.81
163 0.87
164 0.89
165 0.89
166 0.87
167 0.82
168 0.77
169 0.72
170 0.64
171 0.58
172 0.48
173 0.39
174 0.32
175 0.27
176 0.21
177 0.14
178 0.11
179 0.08
180 0.12
181 0.12
182 0.12
183 0.11
184 0.11
185 0.11
186 0.12
187 0.11
188 0.11
189 0.13
190 0.16
191 0.22
192 0.29
193 0.32
194 0.4
195 0.5
196 0.56
197 0.62
198 0.69
199 0.69
200 0.72
201 0.8
202 0.81
203 0.79
204 0.74
205 0.72
206 0.71
207 0.72
208 0.66
209 0.59
210 0.54
211 0.55
212 0.58
213 0.55
214 0.52
215 0.47
216 0.49
217 0.54
218 0.49
219 0.45
220 0.42
221 0.4
222 0.44
223 0.45
224 0.43
225 0.44
226 0.45
227 0.45
228 0.5
229 0.5
230 0.46
231 0.5
232 0.56
233 0.52
234 0.58
235 0.57
236 0.56
237 0.58
238 0.59
239 0.6
240 0.61
241 0.64
242 0.62
243 0.68
244 0.7
245 0.76
246 0.73
247 0.69
248 0.65
249 0.59
250 0.55
251 0.53
252 0.45
253 0.35
254 0.32
255 0.27
256 0.21
257 0.17
258 0.15
259 0.07
260 0.04
261 0.03
262 0.04
263 0.04
264 0.04
265 0.06
266 0.07
267 0.07
268 0.08
269 0.08
270 0.08
271 0.09
272 0.09
273 0.08
274 0.09
275 0.09
276 0.17
277 0.19
278 0.22
279 0.24
280 0.26
281 0.29
282 0.35
283 0.45
284 0.46
285 0.5
286 0.55
287 0.55
288 0.55
289 0.57
290 0.58
291 0.53
292 0.47
293 0.42
294 0.38
295 0.34
296 0.33
297 0.32
298 0.24
299 0.19
300 0.16
301 0.15
302 0.12
303 0.11
304 0.11
305 0.08
306 0.09
307 0.1
308 0.13
309 0.13
310 0.14
311 0.16
312 0.17
313 0.19
314 0.18
315 0.18
316 0.16
317 0.16
318 0.16
319 0.13
320 0.12
321 0.09
322 0.1
323 0.09
324 0.09
325 0.08
326 0.07
327 0.08
328 0.08
329 0.1
330 0.13
331 0.17
332 0.18
333 0.21
334 0.25
335 0.27
336 0.33
337 0.34
338 0.33
339 0.35
340 0.38
341 0.37
342 0.38
343 0.37
344 0.31
345 0.29
346 0.26
347 0.21
348 0.17
349 0.14
350 0.13
351 0.11
352 0.1
353 0.1
354 0.09
355 0.09
356 0.08
357 0.08
358 0.06
359 0.11
360 0.11
361 0.11
362 0.1
363 0.1
364 0.11
365 0.11
366 0.11
367 0.06
368 0.05
369 0.05
370 0.05
371 0.06
372 0.06
373 0.06
374 0.05
375 0.06
376 0.06
377 0.07
378 0.08
379 0.08
380 0.08
381 0.08
382 0.09
383 0.12
384 0.19
385 0.26
386 0.26
387 0.27
388 0.34
389 0.39
390 0.47
391 0.45
392 0.4
393 0.34
394 0.34
395 0.33
396 0.25
397 0.23
398 0.16
399 0.19
400 0.22
401 0.21
402 0.2
403 0.21
404 0.26
405 0.3
406 0.39
407 0.43
408 0.45
409 0.53
410 0.64
411 0.69
412 0.72
413 0.72
414 0.7
415 0.68
416 0.7
417 0.62
418 0.55
419 0.57
420 0.5
421 0.48
422 0.45
423 0.42
424 0.34
425 0.38
426 0.36
427 0.35
428 0.34
429 0.32
430 0.29
431 0.28
432 0.33
433 0.3
434 0.33
435 0.29
436 0.29
437 0.27
438 0.31
439 0.35
440 0.32
441 0.31
442 0.28
443 0.26
444 0.25
445 0.25
446 0.2
447 0.16
448 0.14
449 0.15
450 0.13
451 0.15
452 0.16
453 0.16
454 0.15
455 0.14
456 0.19
457 0.18
458 0.23
459 0.24
460 0.22
461 0.22
462 0.23
463 0.25
464 0.26
465 0.34
466 0.33
467 0.3
468 0.35
469 0.41
470 0.46
471 0.47
472 0.48
473 0.47
474 0.53
475 0.59
476 0.62
477 0.59
478 0.54
479 0.57
480 0.59
481 0.59
482 0.5
483 0.45
484 0.42
485 0.41
486 0.41
487 0.39
488 0.38
489 0.39
490 0.43
491 0.43
492 0.38
493 0.39
494 0.4
495 0.36
496 0.29
497 0.25
498 0.25
499 0.27
500 0.28
501 0.25
502 0.24
503 0.23
504 0.22
505 0.18
506 0.17
507 0.16
508 0.15
509 0.16
510 0.15
511 0.17
512 0.2
513 0.23
514 0.28
515 0.28
516 0.37
517 0.4
518 0.4
519 0.44
520 0.49
521 0.52
522 0.54
523 0.63
524 0.63
525 0.7
526 0.77
527 0.79
528 0.83
529 0.82
530 0.83
531 0.81
532 0.8
533 0.73
534 0.66
535 0.59
536 0.49