Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q7JE46

Protein Details
Accession A0A4Q7JE46    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAGAKKQKKKWSKGKVKDKAQHAVLHydrophilic
NLS Segment(s)
PositionSequence
6-22GAKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 15.5, mito_nucl 13, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGAKKQKKKWSKGKVKDKAQHAVLLDKTTSEKLYKDVQSYRLVTVATLVDRMKVNGSLARQCLNDLEEKGLIKPVVTHSKMKIYSMHRPSKRLYTSENQRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.93
7 0.9
8 0.86
9 0.82
10 0.73
11 0.66
12 0.56
13 0.51
14 0.42
15 0.36
16 0.29
17 0.21
18 0.21
19 0.18
20 0.18
21 0.14
22 0.13
23 0.14
24 0.21
25 0.23
26 0.25
27 0.27
28 0.29
29 0.33
30 0.34
31 0.31
32 0.26
33 0.23
34 0.19
35 0.17
36 0.14
37 0.09
38 0.09
39 0.08
40 0.09
41 0.09
42 0.09
43 0.09
44 0.09
45 0.09
46 0.1
47 0.12
48 0.14
49 0.15
50 0.17
51 0.16
52 0.16
53 0.16
54 0.15
55 0.16
56 0.14
57 0.15
58 0.14
59 0.15
60 0.15
61 0.16
62 0.15
63 0.12
64 0.13
65 0.17
66 0.25
67 0.27
68 0.3
69 0.3
70 0.39
71 0.4
72 0.4
73 0.41
74 0.38
75 0.45
76 0.51
77 0.59
78 0.56
79 0.59
80 0.62
81 0.65
82 0.64
83 0.58
84 0.55
85 0.56