Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q7JTV5

Protein Details
Accession A0A4Q7JTV5    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-26PGSVSSRLAKRKRQDSPPVPTAPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto_nucl 5, nucl 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001487  Bromodomain  
IPR036427  Bromodomain-like_sf  
Pfam View protein in Pfam  
PF00439  Bromodomain  
Amino Acid Sequences MATPGSVSSRLAKRKRQDSPPVPTAPPTQVLWTRGFTKVSSSALDQISSHRDANMFATGVRERDAPNYRQIVLQPQDITSIRSAIKQGNKAAVQAAGSLPGGDPGTASVWLPISEDLVPPKGIVNSAQLERELVHMFCNAIMYNPDPDRGPGSAFLKRSQDEEEEVVGYRVDENGVVKNTRSMFVEVEKLLGDLRSAEKDRGAPPPPSATRQASVATPADDTAEDEDELAGDGNTAASVVKRRRIATRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.77
3 0.79
4 0.82
5 0.82
6 0.84
7 0.83
8 0.79
9 0.7
10 0.65
11 0.59
12 0.51
13 0.45
14 0.36
15 0.34
16 0.33
17 0.34
18 0.34
19 0.33
20 0.33
21 0.33
22 0.33
23 0.27
24 0.27
25 0.28
26 0.27
27 0.26
28 0.24
29 0.26
30 0.26
31 0.26
32 0.22
33 0.21
34 0.24
35 0.24
36 0.23
37 0.18
38 0.18
39 0.18
40 0.2
41 0.19
42 0.15
43 0.12
44 0.15
45 0.15
46 0.15
47 0.16
48 0.15
49 0.14
50 0.21
51 0.27
52 0.26
53 0.31
54 0.33
55 0.33
56 0.33
57 0.33
58 0.34
59 0.31
60 0.32
61 0.26
62 0.23
63 0.26
64 0.25
65 0.26
66 0.18
67 0.18
68 0.15
69 0.15
70 0.17
71 0.18
72 0.23
73 0.26
74 0.27
75 0.3
76 0.3
77 0.29
78 0.28
79 0.23
80 0.18
81 0.15
82 0.13
83 0.08
84 0.08
85 0.07
86 0.06
87 0.07
88 0.06
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.05
96 0.06
97 0.06
98 0.07
99 0.06
100 0.07
101 0.07
102 0.07
103 0.08
104 0.09
105 0.09
106 0.08
107 0.09
108 0.08
109 0.07
110 0.08
111 0.09
112 0.1
113 0.11
114 0.12
115 0.11
116 0.11
117 0.11
118 0.12
119 0.11
120 0.09
121 0.08
122 0.08
123 0.08
124 0.08
125 0.09
126 0.06
127 0.06
128 0.07
129 0.07
130 0.1
131 0.11
132 0.11
133 0.11
134 0.12
135 0.13
136 0.13
137 0.13
138 0.13
139 0.16
140 0.19
141 0.2
142 0.23
143 0.24
144 0.24
145 0.25
146 0.25
147 0.23
148 0.21
149 0.21
150 0.2
151 0.17
152 0.16
153 0.15
154 0.12
155 0.1
156 0.08
157 0.07
158 0.06
159 0.06
160 0.06
161 0.09
162 0.12
163 0.12
164 0.12
165 0.16
166 0.17
167 0.18
168 0.19
169 0.18
170 0.17
171 0.18
172 0.23
173 0.18
174 0.18
175 0.17
176 0.15
177 0.14
178 0.12
179 0.1
180 0.07
181 0.1
182 0.14
183 0.16
184 0.17
185 0.19
186 0.22
187 0.25
188 0.31
189 0.33
190 0.29
191 0.3
192 0.38
193 0.4
194 0.4
195 0.43
196 0.4
197 0.38
198 0.38
199 0.37
200 0.29
201 0.29
202 0.27
203 0.22
204 0.18
205 0.17
206 0.16
207 0.14
208 0.15
209 0.13
210 0.13
211 0.12
212 0.12
213 0.12
214 0.1
215 0.11
216 0.1
217 0.07
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.06
225 0.15
226 0.2
227 0.27
228 0.32
229 0.36