Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q7JVH0

Protein Details
Accession A0A4Q7JVH0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPKVKRGKKDDGKKKRGPKRGLSAYMFBasic
NLS Segment(s)
PositionSequence
3-21KVKRGKKDDGKKKRGPKRG
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKVKRGKKDDGKKKRGPKRGLSAYMFFANEQRENVRAENPNITFGQVGKVLGERWKALNDKQRAPYEAKAAADKKRYEDEKAAFQAEDDSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.9
4 0.87
5 0.85
6 0.84
7 0.84
8 0.82
9 0.75
10 0.68
11 0.61
12 0.55
13 0.46
14 0.35
15 0.28
16 0.23
17 0.2
18 0.19
19 0.17
20 0.16
21 0.17
22 0.18
23 0.21
24 0.21
25 0.22
26 0.26
27 0.24
28 0.25
29 0.23
30 0.23
31 0.18
32 0.15
33 0.14
34 0.1
35 0.09
36 0.07
37 0.07
38 0.08
39 0.1
40 0.11
41 0.11
42 0.11
43 0.15
44 0.17
45 0.22
46 0.3
47 0.33
48 0.39
49 0.44
50 0.47
51 0.47
52 0.49
53 0.46
54 0.43
55 0.4
56 0.35
57 0.35
58 0.36
59 0.39
60 0.41
61 0.4
62 0.4
63 0.45
64 0.47
65 0.46
66 0.49
67 0.47
68 0.49
69 0.51
70 0.49
71 0.4
72 0.37