Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q7JVE9

Protein Details
Accession A0A4Q7JVE9   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
87-127WPNPDKDKPKDPKAKKAPSQPKKAQVPKKGQKRLNTKREQSHydrophilic
NLS Segment(s)
PositionSequence
92-122KDKPKDPKAKKAPSQPKKAQVPKKGQKRLNT
Subcellular Location(s) nucl 14.5, mito_nucl 8.5, cyto 8, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR016197  Chromo-like_dom_sf  
IPR002717  HAT_MYST-type  
IPR025995  Tudor-knot  
IPR036388  WH-like_DNA-bd_sf  
IPR040706  Zf-MYST  
Gene Ontology GO:0005694  C:chromosome  
GO:0005634  C:nucleus  
GO:0004402  F:histone acetyltransferase activity  
GO:0106226  F:peptide 2-hydroxyisobutyryltransferase activity  
GO:0140064  F:peptide crotonyltransferase activity  
GO:0006281  P:DNA repair  
GO:0016573  P:histone acetylation  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF01853  MOZ_SAS  
PF11717  Tudor-knot  
PF17772  zf-MYST  
PROSITE View protein in PROSITE  
PS51726  MYST_HAT  
Amino Acid Sequences MAAGTPAAEPTVGSDTPRQKGIATPDTLKTGSIAWVVKDGEPRRAEILSIKETKSGKQFYCNFDNFNKRLDEWVPVARIDFTQEVEWPNPDKDKPKDPKAKKAPSQPKKAQVPKKGQKRLNTKREQSVHSEAATPHPWSEFVESQQQRQTSSVRPDGDSQTQASADAIATPAAADDLEADDKEDDIKKEEGEFSREEEIEKLRTSGSMTQNPAEISRIRNISKVQFGRNDLFPWYFSPYPEVFSQEDVIFICEFCLSYYGDEVAFLRHRKKCLLSYRQYWSENILDLLMGYNERDDKVTIEAISSALAMTTQDVEHTLQAMKMQVYHKSDHKIVIPDNLIQQREKQKLKSDVGLVRKYGDLYRKRLAAQTIIDPIVMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.3
3 0.34
4 0.36
5 0.34
6 0.29
7 0.34
8 0.41
9 0.41
10 0.39
11 0.4
12 0.4
13 0.44
14 0.43
15 0.38
16 0.3
17 0.23
18 0.21
19 0.21
20 0.19
21 0.16
22 0.2
23 0.21
24 0.23
25 0.3
26 0.3
27 0.34
28 0.34
29 0.36
30 0.35
31 0.33
32 0.32
33 0.29
34 0.33
35 0.33
36 0.36
37 0.35
38 0.37
39 0.38
40 0.41
41 0.44
42 0.45
43 0.39
44 0.44
45 0.5
46 0.51
47 0.59
48 0.57
49 0.53
50 0.53
51 0.6
52 0.52
53 0.5
54 0.46
55 0.37
56 0.39
57 0.37
58 0.33
59 0.27
60 0.31
61 0.29
62 0.26
63 0.26
64 0.23
65 0.21
66 0.21
67 0.18
68 0.14
69 0.14
70 0.16
71 0.18
72 0.18
73 0.21
74 0.2
75 0.21
76 0.24
77 0.26
78 0.32
79 0.34
80 0.43
81 0.5
82 0.57
83 0.66
84 0.68
85 0.76
86 0.79
87 0.84
88 0.81
89 0.83
90 0.84
91 0.83
92 0.87
93 0.84
94 0.82
95 0.82
96 0.85
97 0.83
98 0.81
99 0.82
100 0.81
101 0.85
102 0.85
103 0.8
104 0.79
105 0.82
106 0.83
107 0.83
108 0.83
109 0.78
110 0.78
111 0.78
112 0.72
113 0.67
114 0.63
115 0.55
116 0.46
117 0.42
118 0.34
119 0.32
120 0.31
121 0.25
122 0.18
123 0.16
124 0.16
125 0.14
126 0.19
127 0.16
128 0.16
129 0.25
130 0.26
131 0.28
132 0.32
133 0.31
134 0.27
135 0.27
136 0.28
137 0.24
138 0.29
139 0.32
140 0.3
141 0.3
142 0.33
143 0.35
144 0.35
145 0.3
146 0.25
147 0.2
148 0.18
149 0.17
150 0.14
151 0.1
152 0.07
153 0.06
154 0.05
155 0.04
156 0.04
157 0.04
158 0.04
159 0.03
160 0.03
161 0.03
162 0.03
163 0.04
164 0.04
165 0.04
166 0.05
167 0.05
168 0.05
169 0.07
170 0.08
171 0.07
172 0.1
173 0.11
174 0.1
175 0.11
176 0.15
177 0.14
178 0.16
179 0.16
180 0.15
181 0.17
182 0.17
183 0.17
184 0.15
185 0.16
186 0.15
187 0.14
188 0.12
189 0.1
190 0.1
191 0.11
192 0.17
193 0.21
194 0.24
195 0.25
196 0.25
197 0.26
198 0.26
199 0.25
200 0.2
201 0.16
202 0.13
203 0.16
204 0.19
205 0.19
206 0.21
207 0.23
208 0.24
209 0.31
210 0.32
211 0.31
212 0.32
213 0.34
214 0.35
215 0.34
216 0.32
217 0.27
218 0.24
219 0.21
220 0.19
221 0.21
222 0.18
223 0.17
224 0.21
225 0.19
226 0.2
227 0.2
228 0.22
229 0.18
230 0.18
231 0.2
232 0.15
233 0.15
234 0.13
235 0.14
236 0.1
237 0.09
238 0.08
239 0.06
240 0.07
241 0.06
242 0.07
243 0.06
244 0.07
245 0.08
246 0.08
247 0.08
248 0.08
249 0.08
250 0.1
251 0.14
252 0.16
253 0.23
254 0.27
255 0.29
256 0.33
257 0.37
258 0.43
259 0.49
260 0.57
261 0.57
262 0.6
263 0.66
264 0.69
265 0.66
266 0.58
267 0.52
268 0.43
269 0.36
270 0.29
271 0.21
272 0.14
273 0.12
274 0.12
275 0.08
276 0.06
277 0.06
278 0.07
279 0.08
280 0.08
281 0.1
282 0.1
283 0.1
284 0.13
285 0.15
286 0.13
287 0.13
288 0.13
289 0.12
290 0.11
291 0.1
292 0.07
293 0.05
294 0.05
295 0.04
296 0.05
297 0.06
298 0.06
299 0.06
300 0.08
301 0.09
302 0.09
303 0.11
304 0.11
305 0.1
306 0.12
307 0.14
308 0.13
309 0.16
310 0.19
311 0.24
312 0.27
313 0.3
314 0.35
315 0.38
316 0.4
317 0.4
318 0.42
319 0.41
320 0.4
321 0.43
322 0.4
323 0.36
324 0.42
325 0.43
326 0.41
327 0.36
328 0.42
329 0.44
330 0.51
331 0.54
332 0.52
333 0.56
334 0.63
335 0.67
336 0.66
337 0.64
338 0.63
339 0.65
340 0.64
341 0.56
342 0.49
343 0.45
344 0.41
345 0.39
346 0.41
347 0.39
348 0.41
349 0.47
350 0.49
351 0.5
352 0.53
353 0.51
354 0.48
355 0.44
356 0.43
357 0.42
358 0.38