Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D5G3V1

Protein Details
Accession D5G3V1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
156-178FITFSTPKKIKRKPLLRTTPSPGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
KEGG tml:GSTUM_00003815001  -  
Amino Acid Sequences MPQQQPIPDSWIFDIYEDTVEETLQNLVEFSTHTLDISDNEETSGELDLGKENIPPSRLAEILSTPRENRMSVDAPVKCIPQRQTPAIGPGGRAPRVRREPLREMKEEELVQPGKKTAQDEDMIKKVMNGKEEMQSDKITTTITMTKLPTLSNDSFITFSTPKKIKRKPLLRTTPSPGWKIWESDHDDDANDDNENLPPLPPATKGDLEMPLLAGTRRKRALGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.17
3 0.17
4 0.14
5 0.14
6 0.11
7 0.11
8 0.11
9 0.1
10 0.09
11 0.08
12 0.08
13 0.06
14 0.06
15 0.07
16 0.07
17 0.09
18 0.11
19 0.1
20 0.11
21 0.11
22 0.12
23 0.13
24 0.16
25 0.15
26 0.12
27 0.12
28 0.12
29 0.11
30 0.12
31 0.11
32 0.07
33 0.06
34 0.06
35 0.07
36 0.08
37 0.08
38 0.09
39 0.1
40 0.12
41 0.13
42 0.13
43 0.15
44 0.17
45 0.17
46 0.16
47 0.17
48 0.18
49 0.22
50 0.25
51 0.24
52 0.22
53 0.26
54 0.26
55 0.25
56 0.23
57 0.23
58 0.22
59 0.22
60 0.29
61 0.26
62 0.28
63 0.29
64 0.3
65 0.25
66 0.28
67 0.29
68 0.29
69 0.33
70 0.32
71 0.35
72 0.34
73 0.37
74 0.36
75 0.33
76 0.25
77 0.25
78 0.27
79 0.25
80 0.27
81 0.25
82 0.3
83 0.36
84 0.41
85 0.41
86 0.45
87 0.51
88 0.58
89 0.62
90 0.55
91 0.53
92 0.49
93 0.47
94 0.4
95 0.31
96 0.27
97 0.22
98 0.2
99 0.17
100 0.15
101 0.13
102 0.14
103 0.15
104 0.11
105 0.13
106 0.16
107 0.18
108 0.21
109 0.22
110 0.22
111 0.2
112 0.2
113 0.23
114 0.22
115 0.21
116 0.19
117 0.19
118 0.23
119 0.25
120 0.26
121 0.22
122 0.21
123 0.2
124 0.18
125 0.16
126 0.12
127 0.1
128 0.1
129 0.11
130 0.12
131 0.14
132 0.15
133 0.16
134 0.16
135 0.16
136 0.16
137 0.2
138 0.19
139 0.2
140 0.2
141 0.2
142 0.19
143 0.19
144 0.22
145 0.17
146 0.17
147 0.22
148 0.27
149 0.34
150 0.44
151 0.51
152 0.57
153 0.66
154 0.76
155 0.77
156 0.83
157 0.86
158 0.83
159 0.82
160 0.8
161 0.78
162 0.73
163 0.65
164 0.55
165 0.5
166 0.44
167 0.4
168 0.35
169 0.34
170 0.36
171 0.37
172 0.39
173 0.34
174 0.32
175 0.3
176 0.3
177 0.23
178 0.16
179 0.13
180 0.11
181 0.12
182 0.13
183 0.12
184 0.11
185 0.11
186 0.12
187 0.13
188 0.14
189 0.17
190 0.21
191 0.22
192 0.23
193 0.26
194 0.27
195 0.27
196 0.26
197 0.23
198 0.18
199 0.17
200 0.17
201 0.2
202 0.21
203 0.28
204 0.3