FuNGI

A0A4Q7JZN3

Protein Details

Accession

A0A4Q7JZN3

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
401-420	SVGKVRQRQKCTSLTRRPFS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

extr 24, cyto 1.5, cyto_nucl 1.5

Family & Domain DBs

InterPro	View protein in InterPro IPR029058 AB_hydrolase IPR022742 Hydrolase_4 IPR005152 Lipase_secreted
Gene Ontology	GO:0004806 F:triglyceride lipase activity GO:0016042 P:lipid catabolic process
Pfam	View protein in Pfam PF12146 Hydrolase_4

Amino Acid Sequences

MKVFYISVLLALGAGARQNSNFNVTPEYAESHDCGSKCQQILDLTNKADLGSVGHDFSFDFFATAANFSTATQPGDVLKVVALNVSNLDVDSGTTVYRIQYASKDLDGETVPATGFIAFPYTPHFAGGSAGNGTSPNLYDYNTWKAAVQRGYAVVATDYAGLGNNFTSHKYLTLPAQVHDVYYSVVAARKIFGETLTGEWVSFGHSQGGGTVWKLAESEYVRNDARYLGTVALAPATYIIDMLMGKYGEVDFSGYLSFLPIAAERALPGYNASFLSDVLRKRIELATKAQLCIAGMLALPADLNKTQLVSPDGLAKDKDRLHEWQKMLSPAQGDRSTAPVLVVQGLNDTSVLPITTVQAWDAACGFGNEVHLRLYPGQEHSPLMEASAPEWLGWLDELFGSVGKVRQRQKCTSLTRRPFSNTFVKQPAEGGRDSLKALKSILRE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.07
2	0.07
3	0.08
4	0.09
5	0.13
6	0.14
7	0.2
8	0.22
9	0.23
10	0.27
11	0.27
12	0.28
13	0.27
14	0.29
15	0.24
16	0.24
17	0.23
18	0.22
19	0.25
20	0.23
21	0.25
22	0.27
23	0.32
24	0.31
25	0.31
26	0.32
27	0.32
28	0.38
29	0.42
30	0.42
31	0.37
32	0.37
33	0.36
34	0.31
35	0.27
36	0.21
37	0.15
38	0.13
39	0.13
40	0.12
41	0.12
42	0.12
43	0.12
44	0.13
45	0.14
46	0.11
47	0.09
48	0.08
49	0.09
50	0.1
51	0.11
52	0.1
53	0.09
54	0.09
55	0.09
56	0.13
57	0.14
58	0.14
59	0.13
60	0.13
61	0.13
62	0.15
63	0.14
64	0.11
65	0.1
66	0.09
67	0.09
68	0.1
69	0.09
70	0.08
71	0.08
72	0.09
73	0.08
74	0.07
75	0.08
76	0.06
77	0.06
78	0.07
79	0.07
80	0.06
81	0.06
82	0.07
83	0.07
84	0.09
85	0.1
86	0.1
87	0.12
88	0.16
89	0.18
90	0.19
91	0.19
92	0.17
93	0.19
94	0.18
95	0.17
96	0.13
97	0.11
98	0.1
99	0.09
100	0.09
101	0.07
102	0.07
103	0.05
104	0.08
105	0.07
106	0.07
107	0.11
108	0.14
109	0.14
110	0.14
111	0.14
112	0.12
113	0.14
114	0.14
115	0.11
116	0.09
117	0.09
118	0.08
119	0.08
120	0.09
121	0.08
122	0.07
123	0.08
124	0.08
125	0.09
126	0.11
127	0.14
128	0.2
129	0.21
130	0.21
131	0.2
132	0.22
133	0.26
134	0.26
135	0.23
136	0.19
137	0.19
138	0.19
139	0.18
140	0.16
141	0.1
142	0.08
143	0.08
144	0.07
145	0.06
146	0.05
147	0.05
148	0.05
149	0.05
150	0.05
151	0.06
152	0.06
153	0.07
154	0.09
155	0.08
156	0.09
157	0.1
158	0.12
159	0.13
160	0.18
161	0.18
162	0.17
163	0.21
164	0.2
165	0.18
166	0.17
167	0.16
168	0.1
169	0.09
170	0.08
171	0.05
172	0.07
173	0.08
174	0.08
175	0.08
176	0.08
177	0.08
178	0.09
179	0.08
180	0.08
181	0.08
182	0.09
183	0.1
184	0.09
185	0.08
186	0.08
187	0.08
188	0.1
189	0.09
190	0.09
191	0.08
192	0.08
193	0.08
194	0.08
195	0.09
196	0.07
197	0.06
198	0.07
199	0.06
200	0.06
201	0.06
202	0.06
203	0.09
204	0.1
205	0.13
206	0.12
207	0.16
208	0.16
209	0.16
210	0.16
211	0.13
212	0.12
213	0.11
214	0.11
215	0.07
216	0.08
217	0.08
218	0.07
219	0.07
220	0.06
221	0.05
222	0.04
223	0.04
224	0.03
225	0.03
226	0.03
227	0.03
228	0.03
229	0.04
230	0.05
231	0.05
232	0.04
233	0.05
234	0.05
235	0.04
236	0.05
237	0.05
238	0.04
239	0.04
240	0.05
241	0.04
242	0.04
243	0.05
244	0.04
245	0.04
246	0.04
247	0.04
248	0.06
249	0.06
250	0.06
251	0.06
252	0.07
253	0.07
254	0.07
255	0.07
256	0.06
257	0.07
258	0.07
259	0.08
260	0.07
261	0.07
262	0.1
263	0.13
264	0.13
265	0.16
266	0.16
267	0.15
268	0.18
269	0.21
270	0.22
271	0.21
272	0.25
273	0.31
274	0.32
275	0.33
276	0.3
277	0.27
278	0.24
279	0.21
280	0.16
281	0.08
282	0.06
283	0.05
284	0.05
285	0.04
286	0.04
287	0.04
288	0.05
289	0.05
290	0.06
291	0.06
292	0.08
293	0.08
294	0.11
295	0.13
296	0.12
297	0.12
298	0.17
299	0.18
300	0.19
301	0.2
302	0.19
303	0.23
304	0.24
305	0.27
306	0.24
307	0.3
308	0.34
309	0.42
310	0.42
311	0.41
312	0.42
313	0.43
314	0.41
315	0.36
316	0.33
317	0.26
318	0.32
319	0.27
320	0.25
321	0.22
322	0.24
323	0.23
324	0.21
325	0.19
326	0.14
327	0.13
328	0.14
329	0.13
330	0.1
331	0.1
332	0.1
333	0.1
334	0.09
335	0.08
336	0.06
337	0.06
338	0.06
339	0.05
340	0.06
341	0.07
342	0.08
343	0.09
344	0.09
345	0.11
346	0.11
347	0.11
348	0.11
349	0.1
350	0.09
351	0.09
352	0.09
353	0.08
354	0.12
355	0.12
356	0.12
357	0.13
358	0.13
359	0.15
360	0.16
361	0.18
362	0.18
363	0.21
364	0.24
365	0.24
366	0.24
367	0.23
368	0.25
369	0.22
370	0.19
371	0.17
372	0.14
373	0.13
374	0.16
375	0.14
376	0.11
377	0.12
378	0.11
379	0.1
380	0.1
381	0.09
382	0.06
383	0.06
384	0.07
385	0.07
386	0.07
387	0.07
388	0.08
389	0.12
390	0.17
391	0.25
392	0.33
393	0.41
394	0.49
395	0.56
396	0.62
397	0.68
398	0.73
399	0.77
400	0.79
401	0.8
402	0.79
403	0.78
404	0.78
405	0.72
406	0.67
407	0.67
408	0.62
409	0.6
410	0.6
411	0.56
412	0.49
413	0.5
414	0.51
415	0.45
416	0.39
417	0.35
418	0.32
419	0.32
420	0.33
421	0.35
422	0.29
423	0.26
424	0.28

A0A4Q7JZN3

3D AlphaFold-predicted Structure Viewer