Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q7JP36

Protein Details
Accession A0A4Q7JP36    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
162-199KSVDKEEHLKEKKKRMNRLKKLRKRAKKKAGKDGDGDGBasic
NLS Segment(s)
PositionSequence
153-193KERAEVDAKKSVDKEEHLKEKKKRMNRLKKLRKRAKKKAGK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFELPEAKRVRREDLNKEDGSSWSDSGDDFNPDLQAQLNAQIARSLGLNVHEPVQTVGKSDPKDHTSTTDSANPAQDSHKEQGDENSDDDLGEFEFRLFSAPDAPSKVVLEDEQAPLGEGALENQRPLSYYLVRDVSESKKREYLAAAVKAGKERAEVDAKKSVDKEEHLKEKKKRMNRLKKLRKRAKKKAGKDGDGDGDESGGESGGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.62
4 0.61
5 0.56
6 0.47
7 0.43
8 0.36
9 0.26
10 0.18
11 0.18
12 0.15
13 0.17
14 0.17
15 0.16
16 0.13
17 0.14
18 0.15
19 0.14
20 0.15
21 0.13
22 0.12
23 0.1
24 0.13
25 0.15
26 0.14
27 0.14
28 0.15
29 0.14
30 0.13
31 0.13
32 0.1
33 0.08
34 0.09
35 0.12
36 0.11
37 0.13
38 0.13
39 0.13
40 0.14
41 0.16
42 0.14
43 0.14
44 0.15
45 0.19
46 0.2
47 0.22
48 0.26
49 0.27
50 0.29
51 0.28
52 0.3
53 0.29
54 0.29
55 0.29
56 0.29
57 0.27
58 0.26
59 0.27
60 0.23
61 0.2
62 0.2
63 0.2
64 0.2
65 0.21
66 0.21
67 0.2
68 0.2
69 0.23
70 0.26
71 0.25
72 0.21
73 0.2
74 0.17
75 0.16
76 0.16
77 0.12
78 0.07
79 0.06
80 0.05
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.05
87 0.08
88 0.09
89 0.1
90 0.12
91 0.12
92 0.12
93 0.12
94 0.12
95 0.09
96 0.08
97 0.09
98 0.09
99 0.09
100 0.09
101 0.09
102 0.09
103 0.08
104 0.08
105 0.06
106 0.04
107 0.04
108 0.07
109 0.08
110 0.07
111 0.08
112 0.08
113 0.09
114 0.1
115 0.13
116 0.12
117 0.13
118 0.16
119 0.18
120 0.19
121 0.19
122 0.21
123 0.24
124 0.3
125 0.31
126 0.3
127 0.31
128 0.32
129 0.32
130 0.3
131 0.3
132 0.3
133 0.31
134 0.31
135 0.29
136 0.29
137 0.3
138 0.29
139 0.23
140 0.17
141 0.14
142 0.17
143 0.24
144 0.24
145 0.27
146 0.33
147 0.34
148 0.35
149 0.35
150 0.34
151 0.29
152 0.31
153 0.34
154 0.35
155 0.45
156 0.51
157 0.59
158 0.64
159 0.71
160 0.76
161 0.78
162 0.8
163 0.81
164 0.85
165 0.87
166 0.9
167 0.91
168 0.93
169 0.96
170 0.96
171 0.95
172 0.95
173 0.95
174 0.95
175 0.94
176 0.93
177 0.93
178 0.93
179 0.87
180 0.8
181 0.75
182 0.71
183 0.62
184 0.53
185 0.41
186 0.31
187 0.25
188 0.21
189 0.15