Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q7K0H8

Protein Details
Accession A0A4Q7K0H8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
82-101YRCPTTCQKGKRIHDSCRKYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 19, cyto 2, mito 1, plas 1, cyto_nucl 1, pero 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MQFSIAAILALASAAVAAPTAAGHHEGKWHHYCTDSLLNVDVDIDLDLDVNVLGLLRLDLDLDVDLDIEILRRKHPNCKAIYRCPTTCQKGKRIHDSCRKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.03
8 0.04
9 0.07
10 0.08
11 0.09
12 0.14
13 0.15
14 0.21
15 0.25
16 0.27
17 0.25
18 0.25
19 0.25
20 0.25
21 0.31
22 0.25
23 0.21
24 0.2
25 0.19
26 0.17
27 0.17
28 0.12
29 0.06
30 0.06
31 0.05
32 0.04
33 0.04
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.07
57 0.08
58 0.11
59 0.17
60 0.2
61 0.3
62 0.38
63 0.45
64 0.49
65 0.59
66 0.64
67 0.68
68 0.76
69 0.73
70 0.68
71 0.66
72 0.68
73 0.66
74 0.66
75 0.63
76 0.63
77 0.66
78 0.72
79 0.78
80 0.76
81 0.78