Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q1BM69

Protein Details
Accession A0A4Q1BM69    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MPSHVPIVKKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-45KKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFK
Subcellular Location(s) nucl 14.5, mito_nucl 11.5, mito 7.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MPSHVPIVKKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQLPMPSIGYGSNKKTRHLIPSGHKDFLVHNISELELLLMHNNKYAASIAHGVSSKKRVEIIARARALGVKVTNAAGKLRTEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.9
5 0.9
6 0.9
7 0.88
8 0.86
9 0.83
10 0.76
11 0.66
12 0.62
13 0.61
14 0.59
15 0.61
16 0.61
17 0.59
18 0.57
19 0.58
20 0.61
21 0.63
22 0.64
23 0.64
24 0.66
25 0.71
26 0.78
27 0.83
28 0.76
29 0.73
30 0.71
31 0.68
32 0.67
33 0.63
34 0.61
35 0.6
36 0.6
37 0.53
38 0.45
39 0.39
40 0.29
41 0.26
42 0.2
43 0.2
44 0.25
45 0.25
46 0.26
47 0.3
48 0.31
49 0.33
50 0.34
51 0.36
52 0.36
53 0.45
54 0.48
55 0.44
56 0.42
57 0.37
58 0.34
59 0.34
60 0.29
61 0.19
62 0.16
63 0.15
64 0.15
65 0.15
66 0.14
67 0.07
68 0.05
69 0.05
70 0.06
71 0.07
72 0.07
73 0.08
74 0.09
75 0.09
76 0.09
77 0.1
78 0.08
79 0.1
80 0.12
81 0.11
82 0.14
83 0.16
84 0.16
85 0.19
86 0.24
87 0.23
88 0.21
89 0.22
90 0.22
91 0.25
92 0.33
93 0.39
94 0.43
95 0.42
96 0.42
97 0.4
98 0.4
99 0.36
100 0.31
101 0.23
102 0.16
103 0.16
104 0.17
105 0.19
106 0.18
107 0.19
108 0.18
109 0.18