Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q1BWE0

Protein Details
Accession A0A4Q1BWE0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSNRPSRRLRKGITVRPRPGPRHBasic
NLS Segment(s)
PositionSequence
6-22SRRLRKGITVRPRPGPR
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MSNRPSRRLRKGITVRPRPGPRHPLIRLSTDLSGPSEENVSPPQATEDYFGMGKQVWAKIRSGVLNDKVPGQKRSKRYTSTFFQKKRLNPFNVIDLPLSSLLFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.79
4 0.83
5 0.78
6 0.76
7 0.75
8 0.7
9 0.7
10 0.67
11 0.65
12 0.6
13 0.58
14 0.51
15 0.45
16 0.4
17 0.31
18 0.28
19 0.21
20 0.19
21 0.15
22 0.13
23 0.11
24 0.1
25 0.11
26 0.11
27 0.11
28 0.1
29 0.1
30 0.11
31 0.1
32 0.1
33 0.1
34 0.1
35 0.09
36 0.1
37 0.09
38 0.08
39 0.08
40 0.08
41 0.08
42 0.1
43 0.12
44 0.13
45 0.14
46 0.15
47 0.17
48 0.18
49 0.19
50 0.21
51 0.22
52 0.24
53 0.24
54 0.27
55 0.29
56 0.32
57 0.34
58 0.37
59 0.41
60 0.46
61 0.54
62 0.58
63 0.6
64 0.62
65 0.64
66 0.65
67 0.69
68 0.71
69 0.68
70 0.69
71 0.7
72 0.71
73 0.75
74 0.76
75 0.71
76 0.67
77 0.65
78 0.64
79 0.6
80 0.55
81 0.45
82 0.36
83 0.33
84 0.27