Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q1BRF1

Protein Details
Accession A0A4Q1BRF1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-29NRKSPFRLSPTRKTNHRQRLKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MYLKSNGNRKSPFRLSPTRKTNHRQRLKAVDSVISAVEESGVQTRSLVKALELPKEGEMNPRDKYTTFTKHVRGYRKSVHKVPKWTRLTLRDNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.67
3 0.71
4 0.76
5 0.74
6 0.75
7 0.78
8 0.8
9 0.8
10 0.82
11 0.78
12 0.76
13 0.78
14 0.74
15 0.69
16 0.59
17 0.51
18 0.41
19 0.36
20 0.28
21 0.18
22 0.14
23 0.09
24 0.08
25 0.05
26 0.05
27 0.06
28 0.06
29 0.06
30 0.07
31 0.08
32 0.08
33 0.09
34 0.08
35 0.07
36 0.12
37 0.14
38 0.17
39 0.17
40 0.17
41 0.17
42 0.19
43 0.19
44 0.2
45 0.2
46 0.21
47 0.22
48 0.22
49 0.23
50 0.22
51 0.25
52 0.26
53 0.32
54 0.33
55 0.37
56 0.42
57 0.48
58 0.54
59 0.59
60 0.57
61 0.57
62 0.61
63 0.66
64 0.68
65 0.69
66 0.73
67 0.72
68 0.78
69 0.79
70 0.8
71 0.75
72 0.74
73 0.74
74 0.72
75 0.73
76 0.72
77 0.74