Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q1BBU7

Protein Details
Accession A0A4Q1BBU7   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPSVKSESPRTPKKEKKPYDHPNSSSGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MPSVKSESPRTPKKEKKPYDHPNSSSGSKGSGGGAGGGGGGSAVKWSQEDKAMVFDHVRQNGEKDWDKACPGKTSQQCREQWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.85
4 0.86
5 0.9
6 0.9
7 0.89
8 0.81
9 0.75
10 0.69
11 0.61
12 0.52
13 0.41
14 0.32
15 0.23
16 0.21
17 0.16
18 0.12
19 0.1
20 0.08
21 0.08
22 0.06
23 0.05
24 0.04
25 0.03
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.03
33 0.04
34 0.05
35 0.08
36 0.09
37 0.1
38 0.14
39 0.14
40 0.15
41 0.15
42 0.18
43 0.21
44 0.24
45 0.25
46 0.22
47 0.24
48 0.26
49 0.32
50 0.31
51 0.29
52 0.28
53 0.29
54 0.32
55 0.35
56 0.34
57 0.32
58 0.33
59 0.4
60 0.47
61 0.54
62 0.59
63 0.64