Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q1BKV9

Protein Details
Accession A0A4Q1BKV9    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-72ALYGCMREPRRKGRPPKSSINFLLHydrophilic
NLS Segment(s)
PositionSequence
58-65RRKGRPPK
Subcellular Location(s) mito 20, mito_nucl 12.833, cyto_mito 11.833, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MVRFKVRETRKLVKPLCGPELSNLLACFASSGTSLRSASMGPCADAAQALYGCMREPRRKGRPPKSSINFLLGKVGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.65
3 0.62
4 0.55
5 0.48
6 0.4
7 0.41
8 0.33
9 0.28
10 0.22
11 0.17
12 0.15
13 0.14
14 0.11
15 0.07
16 0.07
17 0.06
18 0.06
19 0.06
20 0.08
21 0.09
22 0.08
23 0.09
24 0.08
25 0.08
26 0.11
27 0.11
28 0.09
29 0.09
30 0.09
31 0.09
32 0.08
33 0.08
34 0.06
35 0.05
36 0.06
37 0.05
38 0.05
39 0.06
40 0.11
41 0.17
42 0.22
43 0.29
44 0.39
45 0.49
46 0.59
47 0.69
48 0.75
49 0.8
50 0.81
51 0.85
52 0.82
53 0.81
54 0.74
55 0.7
56 0.62
57 0.52