Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q1BNZ8

Protein Details
Accession A0A4Q1BNZ8   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-40KETKASKKTETTKRAPKEKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
14-37KASKKTETTKRAPKEKKDPNAPKR
92-117KLRAEKDKKAYLATGGGEKKTSKKSK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPQTMPKVSTKETKASKKTETTKRAPKEKKDPNAPKRGLSAYMFFVQDYRPKIKNDHPDVSFGETGKLLGEKWKAMSAAEKKPFEDLAAKDKLRAEKDKKAYLATGGGEKKTSKKSKPAVEEDEEDDEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.64
3 0.66
4 0.67
5 0.72
6 0.74
7 0.74
8 0.73
9 0.76
10 0.79
11 0.83
12 0.83
13 0.82
14 0.83
15 0.84
16 0.84
17 0.85
18 0.88
19 0.86
20 0.88
21 0.81
22 0.72
23 0.66
24 0.59
25 0.51
26 0.42
27 0.34
28 0.27
29 0.26
30 0.24
31 0.2
32 0.18
33 0.16
34 0.18
35 0.2
36 0.22
37 0.23
38 0.24
39 0.29
40 0.35
41 0.44
42 0.47
43 0.49
44 0.45
45 0.45
46 0.44
47 0.44
48 0.37
49 0.27
50 0.21
51 0.14
52 0.13
53 0.1
54 0.09
55 0.06
56 0.08
57 0.09
58 0.09
59 0.1
60 0.11
61 0.11
62 0.11
63 0.19
64 0.21
65 0.29
66 0.35
67 0.35
68 0.34
69 0.35
70 0.35
71 0.3
72 0.29
73 0.22
74 0.22
75 0.28
76 0.27
77 0.28
78 0.31
79 0.35
80 0.35
81 0.42
82 0.43
83 0.45
84 0.53
85 0.57
86 0.55
87 0.52
88 0.48
89 0.41
90 0.37
91 0.29
92 0.29
93 0.25
94 0.24
95 0.24
96 0.25
97 0.29
98 0.36
99 0.43
100 0.42
101 0.5
102 0.58
103 0.65
104 0.73
105 0.76
106 0.73
107 0.71
108 0.68
109 0.63
110 0.59
111 0.5