Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q1BSA3

Protein Details
Accession A0A4Q1BSA3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-33GKSNLRKTTKKTKTPSTPSTPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto_mito 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MANITIKLTVNAGKSNLRKTTKKTKTPSTPSTPTSAHETASAPTSPTTPVLISTDRTLVDPASPVGQAFFFNSSPSGGVPAHLKPNQVVGQVGYLMNMKDLSISTPGQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.44
4 0.47
5 0.49
6 0.54
7 0.63
8 0.66
9 0.71
10 0.72
11 0.74
12 0.77
13 0.81
14 0.82
15 0.79
16 0.75
17 0.67
18 0.65
19 0.55
20 0.46
21 0.45
22 0.37
23 0.29
24 0.24
25 0.23
26 0.19
27 0.2
28 0.18
29 0.12
30 0.11
31 0.11
32 0.1
33 0.1
34 0.1
35 0.08
36 0.09
37 0.1
38 0.11
39 0.11
40 0.11
41 0.12
42 0.11
43 0.11
44 0.11
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.07
54 0.07
55 0.07
56 0.09
57 0.08
58 0.09
59 0.1
60 0.1
61 0.1
62 0.09
63 0.11
64 0.09
65 0.1
66 0.12
67 0.14
68 0.21
69 0.22
70 0.23
71 0.21
72 0.27
73 0.28
74 0.27
75 0.25
76 0.19
77 0.18
78 0.19
79 0.18
80 0.13
81 0.12
82 0.11
83 0.11
84 0.1
85 0.09
86 0.08
87 0.09
88 0.1
89 0.12