Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q1BW09

Protein Details
Accession A0A4Q1BW09    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
225-263ESPSVLRREREKRKREEEEKKRRKKRKLEHDKERTRYYEBasic
NLS Segment(s)
PositionSequence
231-254RREREKRKREEEEKKRRKKRKLEH
Subcellular Location(s) nucl 25, cyto_nucl 13.833, mito_nucl 13.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR018607  Ctf8  
Gene Ontology GO:0031390  C:Ctf18 RFC-like complex  
GO:0007064  P:mitotic sister chromatid cohesion  
Pfam View protein in Pfam  
PF09696  Ctf8  
Amino Acid Sequences MRIHLPLSPDLLKPTVIDPESPLVKLGGEVVLIELQGELSWEGDKSDGVVGVLGLDRPDKPTLHLGPHHLLHGKIVSLPKPLAVIRKSHAPIATTHKADVHSDRNTRGVLEGDVSEEDQEEEEHDPLQTMDTRAGPSKPSKVKKTTEESEEEDEEPLFPMTKPFRTPSRLGKSHGHTPSIKSSSPVYPPSSIQDYSSDLDPTSPYRQDECDRQMTTLHDNEDEMESPSVLRREREKRKREEEEKKRRKKRKLEHDKERTRYYEVVGLVRKKVVFSLRPEPIVTATVLPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.23
4 0.22
5 0.22
6 0.27
7 0.28
8 0.27
9 0.26
10 0.19
11 0.18
12 0.17
13 0.16
14 0.1
15 0.08
16 0.07
17 0.08
18 0.08
19 0.08
20 0.07
21 0.06
22 0.05
23 0.05
24 0.06
25 0.05
26 0.05
27 0.06
28 0.06
29 0.07
30 0.07
31 0.07
32 0.07
33 0.08
34 0.08
35 0.07
36 0.07
37 0.07
38 0.07
39 0.08
40 0.07
41 0.06
42 0.07
43 0.08
44 0.11
45 0.14
46 0.13
47 0.16
48 0.23
49 0.26
50 0.31
51 0.33
52 0.35
53 0.37
54 0.38
55 0.38
56 0.32
57 0.29
58 0.25
59 0.22
60 0.18
61 0.16
62 0.19
63 0.17
64 0.18
65 0.18
66 0.17
67 0.19
68 0.2
69 0.23
70 0.22
71 0.23
72 0.22
73 0.31
74 0.31
75 0.32
76 0.32
77 0.26
78 0.28
79 0.34
80 0.38
81 0.3
82 0.3
83 0.29
84 0.28
85 0.3
86 0.31
87 0.28
88 0.28
89 0.3
90 0.31
91 0.31
92 0.3
93 0.28
94 0.25
95 0.19
96 0.13
97 0.12
98 0.1
99 0.09
100 0.09
101 0.09
102 0.08
103 0.07
104 0.07
105 0.06
106 0.05
107 0.06
108 0.07
109 0.07
110 0.07
111 0.07
112 0.07
113 0.07
114 0.08
115 0.08
116 0.07
117 0.08
118 0.09
119 0.1
120 0.11
121 0.12
122 0.13
123 0.15
124 0.22
125 0.29
126 0.34
127 0.39
128 0.44
129 0.49
130 0.52
131 0.57
132 0.53
133 0.5
134 0.47
135 0.44
136 0.41
137 0.38
138 0.32
139 0.25
140 0.21
141 0.17
142 0.14
143 0.1
144 0.08
145 0.06
146 0.09
147 0.11
148 0.13
149 0.15
150 0.18
151 0.23
152 0.27
153 0.31
154 0.37
155 0.45
156 0.46
157 0.49
158 0.52
159 0.52
160 0.56
161 0.55
162 0.49
163 0.41
164 0.4
165 0.44
166 0.41
167 0.36
168 0.29
169 0.29
170 0.28
171 0.31
172 0.32
173 0.27
174 0.25
175 0.26
176 0.28
177 0.29
178 0.26
179 0.23
180 0.21
181 0.21
182 0.21
183 0.21
184 0.18
185 0.14
186 0.14
187 0.14
188 0.15
189 0.17
190 0.18
191 0.18
192 0.2
193 0.24
194 0.27
195 0.33
196 0.35
197 0.39
198 0.37
199 0.36
200 0.36
201 0.35
202 0.37
203 0.33
204 0.29
205 0.21
206 0.21
207 0.21
208 0.21
209 0.19
210 0.16
211 0.13
212 0.12
213 0.12
214 0.14
215 0.17
216 0.16
217 0.19
218 0.25
219 0.35
220 0.47
221 0.57
222 0.64
223 0.71
224 0.79
225 0.87
226 0.89
227 0.9
228 0.9
229 0.91
230 0.92
231 0.93
232 0.94
233 0.94
234 0.93
235 0.93
236 0.93
237 0.93
238 0.93
239 0.93
240 0.94
241 0.95
242 0.95
243 0.91
244 0.88
245 0.8
246 0.73
247 0.64
248 0.55
249 0.5
250 0.42
251 0.41
252 0.41
253 0.41
254 0.38
255 0.4
256 0.37
257 0.32
258 0.34
259 0.35
260 0.34
261 0.38
262 0.45
263 0.47
264 0.49
265 0.49
266 0.46
267 0.41
268 0.37
269 0.3